TkA03G113280 | RubberDandelionOmics

Gene overview

TkA03G113280

Reference: TK1151 Chr: Chr03 Coordinates: 28985671-28988499 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2080 bp · TkA03G113280|TK1151|cDNA

ATCATATCAATATTTTTTTGAATATATATAAGAGGCTCCACTATGAATTTAAGTCGGATTCAAGATGCACATTGAACCGGTCAGCCCATCTCTGATTCGCTCAGTTTACACGCTCAATTTACAACGCATCGTTGAATGAAAGACGGACGCCTGTTGGTCCTTGCCTCGCCCACATATCGGCGCCTTGCCTCCATCGACACTCTGCAATCTTTCCTTCGACGCAATTTAAGCCTCAATACACCCTCACATCGGCACTCCAC...

CDS

Download CDS FASTA

1545 bp · TkA03G113280|TK1151|CDS

ATGGAAAAGTCAAGGGTTAAAAAGTCCGTAAAAGAAGAAACCGACAACAATACCATTCAGTGGTTGTTAACAGACAAGGGCATATCAGCATCATTCATAATCATAAGTCTATTTTCAATTCTTATACGAGTTGCTGTATCTATCCACCCGTATTCCGGATCTAATGATCCACCAAAATACGGAGATTTTGAAGCACAAAGACATTGGATGGAGATCACAACAAATCTTCCTGTCAATCAATGGTACCACAACAGCACTTC...

Protein

Download Protein FASTA

514 aa · TkA03G113280|TK1151|PROTEIN

MEKSRVKKSVKEETDNNTIQWLLTDKGISASFIIISLFSILIRVAVSIHPYSGSNDPPKYGDFEAQRHWMEITTNLPVNQWYHNSTSNDLTYWGLDYPPLTAYQSYIHGLLLQFFHPDSVSLYSSRGHESYIGKLLMRWTVLASDVLIFFPAVLWFIVVVYARQSRGYKGNLLPWHVAMILLNPCLILIDHGHFQYNCISLGLTIGAVAAILCDKDLVASFLFSLALNHKQMSAYFAPAFFSYLLGKSLRRKNPLLEVVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G113280`
TK1151 ID	TkA03G113280
OH-1004 ID	LXL04_007090
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G113280

Location Chr03:28985671-28988499 (-)

Description Similar to At5g38460: Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38460`	Adds the first glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007090 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0098553 lumenal side of endoplasmic reticulum membrane Cellular Component

GO:0004583 dolichyl-phosphate-glucose-glycolipid alpha-glucosyltransferase activity Molecular Function

GO:0042281 dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase activity Molecular Function

GO:0046527 glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G38460

ddi:DDB_G0283841

dme:Dmel_CG5091

hsa:29929

pon:100174089

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.876

Rank 1 · TkA03G113280 · TK1151

Golgi apparatus0.076

Rank 2 · TkA03G113280 · TK1151

Nucleus0.065

Rank 3 · TkA03G113280 · TK1151

Cytoplasm0.052

Rank 4 · TkA03G113280 · TK1151

Cell membrane0.040

Rank 5 · TkA03G113280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03155Alg6_Alg840-492 aa

PF03896TRAP_alpha433-462 aa

PF03896TRAP_alpha472-492 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G113280	`PF03155`	Alg6_Alg8	40	492	2e-135	453.2
TkA03G113280	`PF03896`	TRAP_alpha	433	462	0.45	10.4
TkA03G113280	`PF03896`	TRAP_alpha	472	492	0.45	10.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FF17`	Arabidopsis thaliana	sp\|Q9FF17\|ALG6_ARATH Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase	64.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card