TkA03G109890 | RubberDandelionOmics

Gene overview

TkA03G109890

Reference: TK1151 Chr: Chr03 Coordinates: 28107390-28108278 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · TkA03G109890|TK1151|cDNA

ACTCAAGGTAACATTGCAAAGTGGTGGAAGAAAGAAGGAGATAAGATAGAAGTGGGTGATATCATATGTGAAATCGAGACAGATAAAGCCACCCTTGAGTTTGAAAGTCTTGAAGAAGGGTTTTTGGCAAAGATATTGGTGCCTGCTGGTGCAAAGGATGTGCATGTTGGACAGCCTATTGCAATTACGGATGAAGAAGCAGAAAATCTTCACAATATCCCTGATAGTGTTCTTGGTGGGTCAGAGGTCAAAGAGGCTGA...

CDS

Download CDS FASTA

504 bp · TkA03G109890|TK1151|CDS

ACTCAAGGTAACATTGCAAAGTGGTGGAAGAAAGAAGGAGATAAGATAGAAGTGGGTGATATCATATGTGAAATCGAGACAGATAAAGCCACCCTTGAGTTTGAAAGTCTTGAAGAAGGGTTTTTGGCAAAGATATTGGTGCCTGCTGGTGCAAAGGATGTGCATGTTGGACAGCCTATTGCAATTACGGATGAAGAAGCAGAAAATCTTCACAATATCCCTGATAGTGTTCTTGGTGGGTCAGAGGTCAAAGAGGCTGA...

Protein

Download Protein FASTA

167 aa · TkA03G109890|TK1151|PROTEIN

TQGNIAKWWKKEGDKIEVGDIICEIETDKATLEFESLEEGFLAKILVPAGAKDVHVGQPIAITDEEAENLHNIPDSVLGGSEVKEAESTQANVKTEDTVTESTSGKVDASNLPPYILIEMPALSPTMDQGNIARWLKKEGDKIEVGDIICEIETDKATLEFECLDEG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G109890`
TK1151 ID	TkA03G109890
OH-1004 ID	LXL04_035567
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 26.217 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G109890

Location Chr03:28107390-28108278 (+)

Description Similar to LTA3: Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52200`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035567 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006006 glucose metabolic process Biological Process

GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0042867 pyruvate catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0045254 pyruvate dehydrogenase complex Cellular Component

GO:0120212 sperm head-tail coupling apparatus Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0004742 dihydrolipoyllysine-residue acetyltransferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G52200

bta:512723

hsa:1737

mmu:235339

rno:81654

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.667

Rank 1 · TkA03G109890 · TK1151

Golgi apparatus0.256

Rank 2 · TkA03G109890 · TK1151

Cell membrane0.156

Rank 3 · TkA03G109890 · TK1151

Nucleus0.154

Rank 4 · TkA03G109890 · TK1151

Endoplasmic reticulum0.126

Rank 5 · TkA03G109890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25997BSH_YhbJ2-61 aa

PF25984BSH_YknX2-41 aa

PF25917BSH_RND2-55 aa

PF00364Biotin_lipoyl3-61 aa

PF26018BSH_RND_rel5-43 aa

PF02749QRPTase_N7-28 aa

PF07831PYNP_C10-27 aa

PF01597GCV_H10-40 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G109890	`PF25997`	BSH_YhbJ	2	61	6e-08	33.3
TkA03G109890	`PF25984`	BSH_YknX	2	41	8.6e-05	23.0
TkA03G109890	`PF25917`	BSH_RND	2	55	0.0013	19.3
TkA03G109890	`PF00364`	Biotin_lipoyl	3	61	2.3e-30	104.9
TkA03G109890	`PF26018`	BSH_RND_rel	5	43	8.2e-11	42.4
TkA03G109890	`PF02749`	QRPTase_N	7	28	0.00019	22.3
TkA03G109890	`PF07831`	PYNP_C	10	27	0.0026	18.1
TkA03G109890	`PF01597`	GCV_H	10	40	0.16	12.6
TkA03G109890	`PF16537`	T2SSB	11	35	0.0071	16.7
TkA03G109890	`PF16886`	ATP-synt_ab_Xtn	11	29	0.0092	16.5
TkA03G109890	`PF29613`	AF_1859_C	12	80	0.096	13.7
TkA03G109890	`PF03293`	Pox_RNA_pol	15	42	0.0037	17.6
TkA03G109890	`PF07831`	PYNP_C	54	61	0.0026	18.1
TkA03G109890	`PF16886`	ATP-synt_ab_Xtn	54	101	0.0092	16.5
TkA03G109890	`PF00364`	Biotin_lipoyl	80	102	2.3e-30	104.9
TkA03G109890	`PF01597`	GCV_H	90	107	0.16	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WQF7`	Arabidopsis thaliana	sp\|Q0WQF7\|ODP21_ARATH Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial	62.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card