TkA03G105760 | RubberDandelionOmics

Gene overview

TkA03G105760

Reference: TK1151 Chr: Chr03 Coordinates: 27082206-27089291 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1562 bp · TkA03G105760|TK1151|cDNA

CAGTCCACCACCTGCTTATTATACTCTTTTTCCTTGCAAGAAAAAGCCGTAGCTTACGAAAACCCCTTCAAGAACCGCTCTCTTTCTCATTCCAACGAGATCTTCTTCACCGCGATGGACCCGCCACCGTCCACCACGGCCGTCGAACCTCCCCATTCCCACTCCCACTCCCTCCCGCCTTTGCCTACTCCCAAAATCCGCCTTATGTGCAGCTACGGTGGCCACATAGTCCCCCGTCCACAAACCAAATCTCTCTGCTA...

CDS

Download CDS FASTA

1500 bp · TkA03G105760|TK1151|CDS

CAGTCCACCACCTGCTTATTATACTCTTTTTCCTTGCAAGAAAAAGCCGTAGCTTACGAAAACCCCTTCAAGAACCGCTCTCTTTCTCATTCCAACGAGATCTTCTTCACCGCGATGGACCCGCCACCGTCCACCACGGCCGTCGAACCTCCCCATTCCCACTCCCACTCCCTCCCGCCTTTGCCTACTCCCAAAATCCGCCTTATGTGCAGCTACGGTGGCCACATAGTCCCCCGTCCACAAACCAAATCTCTCTGCTA...

Protein

Download Protein FASTA

499 aa · TkA03G105760|TK1151|PROTEIN

QSTTCLLYSFSLQEKAVAYENPFKNRSLSHSNEIFFTAMDPPPSTTAVEPPHSHSHSLPPLPTPKIRLMCSYGGHIVPRPQTKSLCYAGGETRIVAVDRRSTGSTISSLTHHLSRTLYGNRPFTLKYQLPNEDLDSLISITTDEDLQNMLEEHDRIASSATPSRIRLFLFPTRPESVGSLLLDPKSETWFSDALKSTMIINRGLSDGSGMANGLMGLDCMEGNGESLMNSGDSGKCGGNGTGGDSGSVPESMVLETCSSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G105760`
TK1151 ID	TkA03G105760
OH-1004 ID	LXL04_007047
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 90.235 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G105760

Location Chr03:27082206-27089291 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16220`	Collaboratively with SUB and QKY, regulates cell growth anisotropy during gynoecium development, thus linking together cell-cell communication and cellular growth.	No verified direct reference in this release
`At1g79570`	RAF-like protein kinase acting, together with RAF24, as a central mediator of a fast response pathway to auxin involving proteins phosphorylation, and leading to rapid cellular responses including membrane depolarization and cytoplasmic streaming.	No verified direct reference in this release
`At2g35050`	RAF-like protein kinase acting, together with RAF20, as a central mediator of a fast response pathway to auxin involving proteins phosphorylation, and leading to rapid cellular responses including membrane depolarization and cytoplasmic streaming.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007047 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005985 sucrose metabolic process Biological Process

GO:0007165 signal transduction Biological Process

GO:0009637 response to blue light Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010109 regulation of photosynthesis Biological Process

GO:0010114 response to red light Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G79570

ath:AT2G35050

ath:AT5G16220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.591

Rank 1 · TkA03G105760 · TK1151

Cytoplasm0.379

Rank 2 · TkA03G105760 · TK1151

Cell membrane0.158

Rank 3 · TkA03G105760 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA03G105760 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA03G105760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00564PB182-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G105760	`PF00564`	PB1	82	171	6e-15	55.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LF06`	Arabidopsis thaliana	sp\|Q9LF06\|POQ_ARATH Protein PAL OF QUIRKY	35.800%	Swiss-Prot	Medium
`Q9SAJ2`	Arabidopsis thaliana	sp\|Q9SAJ2\|RAF20_ARATH RAF-like serine/threonine-protein kinase 20	35.400%	Swiss-Prot	Low
`O64768`	Arabidopsis thaliana	sp\|O64768\|RAF24_ARATH RAF-like serine/threonine-protein kinase 24	42.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card