TkA03G089650 | RubberDandelionOmics

Gene overview

TkA03G089650

Reference: TK1151 Chr: Chr03 Coordinates: 22870512-22874860 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2920 bp · TkA03G089650|TK1151|cDNA

TATAACCCAACCCACATCTCCCTTGTTAATATAAGTATATAACCCACCTTGACCTCGCCCCTGTTAACTTCCGAATCGGAAGTTCCTATATTCTTGGAGTCGTTCACCAAAAAATCAGGCCTGTGATTTGATTAATGGAGTCGTTAACCGATACTCTTGGAGTCGTTAACCCATTGAATCCACATCGCACGACCAGAGATCCCAAAATAAACCCTCCTTGAACCCTAATCAAAGCACACGGCTCAACCAAAATCAACCCT...

CDS

Download CDS FASTA

1344 bp · TkA03G089650|TK1151|CDS

ATGAAGAATGTCATGACGATGACCGTTGATAATGCGAAGACGAACGACGCGGCAATCAACATCATCGTTAAAGAACTTTCGGGTATTTATGAGAATGGCAAACATTTTCACATCAGGTGTATGGCTCATATCATAATCATAATTGTGAAAATGGGGTTAGAGTACGAAGTTTACCATGTAAAAAGCATGCAACAAGCGGTGAAATACATTAGGGCCTCCCCACAACGGATCAAGACCTTTAAACAAGCCATGAAGGATGC...

Protein

Download Protein FASTA

447 aa · TkA03G089650|TK1151|PROTEIN

MKNVMTMTVDNAKTNDAAINIIVKELSGIYENGKHFHIRCMAHIIIIIVKMGLEYEVYHVKSMQQAVKYIRASPQRIKTFKQAMKDADVETQRFLCGETPTRWNSTFELLSSAYDVKDAFLEYSHLDPMFQKSVERIPSHSDFEKIKKMMEFLEKFKKKTEKVLCSTKPIIHTYTREILDIEQHLRKHETKPDFMHMVSEMKKKYDKYWGDYDKIRDYVFFATLLDPQCKSKFMKVVFTQMLKAKNKDNKWSIDEIESKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G089650`
TK1151 ID	TkA03G089650
OH-1004 ID	LXL04_006926
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 69.626 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G089650`
Location	Chr03:22870512-22874860 (+)
Description	No functional description available
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006926` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0009791 post-embryonic development Biological Process GO:0032196 transposition Biological Process GO:0005634 nucleus Cellular Component GO:0003677 DNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0046983 protein dimerization activity Molecular Function
KEGG gene cross-reference	dosa:Os03g0733400 dosa:Os05g0239150 dosa:Os05g0583200 osa:4339741 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.895

Rank 1 · TkA03G089650 · TK1151

Cytoplasm0.198

Rank 2 · TkA03G089650 · TK1151

Mitochondrion0.029

Rank 3 · TkA03G089650 · TK1151

Extracellular0.015

Rank 4 · TkA03G089650 · TK1151

Cell membrane0.014

Rank 5 · TkA03G089650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27039ZBED1_RNase-like_helical38-151 aa

PF27046FAM200-GTF2IRD2-like60-121 aa

PF08696Dna2144-185 aa

PF04778LMP144-207 aa

PF14372hAT-like_RNase-H146-163 aa

PF14372hAT-like_RNase-H173-258 aa

PF08696Dna2220-295 aa

PF04778LMP241-277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G089650	`PF27039`	ZBED1_RNase-like_helical	38	151	2e-20	73.6
TkA03G089650	`PF27046`	FAM200-GTF2IRD2-like	60	121	0.0014	19.2
TkA03G089650	`PF08696`	Dna2	144	185	0.024	15.1
TkA03G089650	`PF04778`	LMP	144	207	2.7	8.6
TkA03G089650	`PF14372`	hAT-like_RNase-H	146	163	5.3e-10	40.1
TkA03G089650	`PF14372`	hAT-like_RNase-H	173	258	5.3e-10	40.1
TkA03G089650	`PF08696`	Dna2	220	295	0.024	15.1
TkA03G089650	`PF04778`	LMP	241	277	2.7	8.6
TkA03G089650	`PF27039`	ZBED1_RNase-like_helical	264	277	2e-20	73.6
TkA03G089650	`PF05699`	Dimer_Tnp_hAT	323	405	5.5e-25	87.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card