RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G085920
Reference: TK1151 Chr: Chr03 Coordinates: 21896703-21898201 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1350 bp · TkA03G085920|TK1151|cDNA

ATGTTACCTGCACCTATCAAGAATACAAATTCCTCTTCCTCTTCCGTACTGCCAGACCACTACCAGACATGTCAACGTTTTACTTTTGCTGAGATTAAATCGGCAACCAACAACTTCGACAAGAGTTTAGTAATCAGTCGTGGAGGATTCGGCGAGGTATATAAAGGCCGCATCAAGATTGGGTCAGTAAGCGAAGTTGCAGTTAAACGATTGCATTCAATGTCCAATCAAGGAGCCCATGAATTTGAAGCTGAAATTCA...

CDS

Download CDS FASTA

1350 bp · TkA03G085920|TK1151|CDS

ATGTTACCTGCACCTATCAAGAATACAAATTCCTCTTCCTCTTCCGTACTGCCAGACCACTACCAGACATGTCAACGTTTTACTTTTGCTGAGATTAAATCGGCAACCAACAACTTCGACAAGAGTTTAGTAATCAGTCGTGGAGGATTCGGCGAGGTATATAAAGGCCGCATCAAGATTGGGTCAGTAAGCGAAGTTGCAGTTAAACGATTGCATTCAATGTCCAATCAAGGAGCCCATGAATTTGAAGCTGAAATTCA...

Protein

Download Protein FASTA

449 aa · TkA03G085920|TK1151|PROTEIN

MLPAPIKNTNSSSSSVLPDHYQTCQRFTFAEIKSATNNFDKSLVISRGGFGEVYKGRIKIGSVSEVAVKRLHSMSNQGAHEFEAEIQVLSKLRHSNLVSLVGFCNEGKEMALVYEFMPNGTLEENLHQPDSYLSWLQLLKISIGAARGLDYLHVGTSTQHGVIHCDVKSSNILLDANFDAKIADFGLAKIGLIERTHVSTAVKGTFGYKDPNYFYTGKLTTSSDVYAFGVVLFEVLTGKKAVDSTLDEEQWSLAVWALHQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G085920
TK1151 IDTkA03G085920
OH-1004 IDLXL04_006886
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)99.800
Protein coverage (%)TK1151 94.655 / OH-1004 37.183
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G085920
LocationChr03:21896703-21898201 (+)
DescriptionNo functional description available
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g51550 May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.
FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
At3g04690 Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell. No verified direct reference in this release
At5g28680 Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell. No verified direct reference in this release
At1g30570 Probable receptor-like protein kinase At1g30570. No verified direct reference in this release
At3g46290 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_006886 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009723 response to ethylene Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0010038 response to metal ion Biological Process
GO:0010118 stomatal movement Biological Process
GO:0010483 pollen tube reception Biological Process
GO:0030308 negative regulation of cell growth Biological Process
GO:0032922 circadian regulation of gene expression Biological Process
KEGG gene cross-reference
ath:AT3G51550
ath:AT5G39000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.509
Rank 1 · TkA03G085920 · TK1151
Cytoplasm0.338
Rank 2 · TkA03G085920 · TK1151
Nucleus0.254
Rank 3 · TkA03G085920 · TK1151
Endoplasmic reticulum0.051
Rank 4 · TkA03G085920 · TK1151
Golgi apparatus0.040
Rank 5 · TkA03G085920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00014Kunitz_BPTI21-41 aa
PF07714PK_Tyr_Ser-Thr44-310 aa
PF00069Pkinase44-308 aa
PF03109ABC148-73 aa
PF01636APH79-130 aa
PF01636APH157-192 aa
PF03109ABC1158-189 aa
PF03109ABC1269-297 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G085920PF00014Kunitz_BPTI21410.312.0
TkA03G085920PF07714PK_Tyr_Ser-Thr443106.1e-48164.1
TkA03G085920PF00069Pkinase443089.8e-42143.9
TkA03G085920PF03109ABC148730.0002421.1
TkA03G085920PF01636APH791300.113.0
TkA03G085920PF01636APH1571920.113.0
TkA03G085920PF03109ABC11581890.0002421.1
TkA03G085920PF03109ABC12692970.0002421.1
TkA03G085920PF00069Pkinase3173519.8e-42143.9
TkA03G085920PF00014Kunitz_BPTI3773930.312.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SCZ4Arabidopsis thalianasp|Q9SCZ4|FERON_ARATH Receptor-like protein kinase FERONIA51.900%Swiss-ProtMedium
Q9SR05Arabidopsis thalianasp|Q9SR05|ANX1_ARATH Receptor-like protein kinase ANXUR151.400%Swiss-ProtMedium
Q3E8W4Arabidopsis thalianasp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR251.400%Swiss-ProtMedium
Q9SA72Arabidopsis thalianasp|Q9SA72|Y1357_ARATH Probable receptor-like protein kinase At1g3057051.500%Swiss-ProtMedium
Q9LX66Arabidopsis thalianasp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 151.300%Swiss-ProtMedium

JBrowse

View in Genome Browser