TkA03G085590 | RubberDandelionOmics

Gene overview

TkA03G085590

Reference: TK1151 Chr: Chr03 Coordinates: 21795055-21795366 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · TkA03G085590|TK1151|cDNA

ATGAAGAGTGAGATCTATGCACTAGGAGTGGTACTACTGGAAATACTAACAGGGATGAAGGTGTATGATAAATGGAGACCCCCTGGAAAGAAAAAATTGGTGGAATGGGCTATTCCATTGCTATCAGACGAAGAAAATTTGAGAATGATTATGGACCCACAACTTCAACATAAGGACTGTCCTCTAAAGGGAGCATTCAAATTGGCTCAACTTGTTTCAAACTGTCTTCAAACCGAAGACAAACGCCCATCAATGGAACA...

CDS

Download CDS FASTA

312 bp · TkA03G085590|TK1151|CDS

ATGAAGAGTGAGATCTATGCACTAGGAGTGGTACTACTGGAAATACTAACAGGGATGAAGGTGTATGATAAATGGAGACCCCCTGGAAAGAAAAAATTGGTGGAATGGGCTATTCCATTGCTATCAGACGAAGAAAATTTGAGAATGATTATGGACCCACAACTTCAACATAAGGACTGTCCTCTAAAGGGAGCATTCAAATTGGCTCAACTTGTTTCAAACTGTCTTCAAACCGAAGACAAACGCCCATCAATGGAACA...

Protein

Download Protein FASTA

103 aa · TkA03G085590|TK1151|PROTEIN

MKSEIYALGVVLLEILTGMKVYDKWRPPGKKKLVEWAIPLLSDEENLRMIMDPQLQHKDCPLKGAFKLAQLVSNCLQTEDKRPSMEQILLVLHHCYQEEIKIV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G085590`
TK1151 ID	TkA03G085590
OH-1004 ID	LXL04_006897
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.600
Protein coverage (%)	TK1151 99.029 / OH-1004 13.446 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G085590

Location Chr03:21795055-21795366 (+)

Description Similar to FER: Receptor-like protein kinase FERONIA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11130`	Regulates the expression of transcription factors that define the cell fates.	No verified direct reference in this release
`At5g11410`	Together with SZE1 and ZED1, required for effector-triggered immunity (e.g.	Two Arabidopsis Receptor-like Cytoplasmic Kinases SZE1 and SZE2 Associate with the ZAR1-ZED1 Complex and Are Required for Effector-Triggered Immunity.2019 · DOI: 10.1016/j.molp.2019.03.012 Investigations into a putative role for the novel BRASSIKIN pseudokinases in compatible pollen-stigma interactions in Arabidopsis thaliana.2019 · DOI: 10.1186/s12870-019-2160-9
`At4g35600`	Acts as a spatial inhibitor of signaling that modulates abscission zone cell adhesion and expansion.	No verified direct reference in this release
`At5g06820`	Protein STRUBBELIG-RECEPTOR FAMILY 2.	No verified direct reference in this release
`At1g24030`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006897 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0030308 negative regulation of cell growth Biological Process

KEGG gene cross-reference

ath:AT3G04690

ath:AT3G46290

ath:AT3G51550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.440

Rank 1 · TkA03G085590 · TK1151

Cell membrane0.428

Rank 2 · TkA03G085590 · TK1151

Nucleus0.228

Rank 3 · TkA03G085590 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkA03G085590 · TK1151

Golgi apparatus0.058

Rank 5 · TkA03G085590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase2-89 aa

PF07714PK_Tyr_Ser-Thr2-89 aa

PF07914DUF167946-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G085590	`PF00069`	Pkinase	2	89	0.0031	17.7
TkA03G085590	`PF07714`	PK_Tyr_Ser-Thr	2	89	0.0068	16.5
TkA03G085590	`PF07914`	DUF1679	46	100	0.051	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWZ1`	Arabidopsis thaliana	sp\|Q8RWZ1\|SUB_ARATH Protein STRUBBELIG	40.400%	Swiss-Prot	Medium
`Q9LFL6`	Arabidopsis thaliana	sp\|Q9LFL6\|BKN2_ARATH Inactive serine/threonine-protein kinase BKN2	40.900%	Swiss-Prot	Medium
`P27450`	Arabidopsis thaliana	sp\|P27450\|CST_ARATH Probable serine/threonine-protein kinase CST	37.200%	Swiss-Prot	Medium
`Q9FG24`	Arabidopsis thaliana	sp\|Q9FG24\|SRF2_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 2	37.600%	Swiss-Prot	Medium
`Q84M95`	Arabidopsis thaliana	sp\|Q84M95\|PBL28_ARATH Probable serine/threonine-protein kinase PBL28	37.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card