Gene Card
Gene overview
cDNA / CDS / Protein Sequences
609 bp · TkA03G084740|TK1151|cDNA
ATCAAATCCGTGAAGATCCGATCGGACGACAGAGGTCAGATCACCTTCCATTACTTCAAATTCACACACACCGGTCATATCACCATCGCCATCTCCTCCGTTTCGGTCACCTCCATCCCGGTCACCTTCACCTTATCCCGACCAGATCCTTTATGTTTCGGTTTCTACCTTCTATCGGAAGAAGCGCGAAATCGATTCAACGAAGACCGTAACACTCTATGCGCCCTCGATTCCAAATTTATCTCACTCCTCTTTAGTTT...
609 bp · TkA03G084740|TK1151|CDS
ATCAAATCCGTGAAGATCCGATCGGACGACAGAGGTCAGATCACCTTCCATTACTTCAAATTCACACACACCGGTCATATCACCATCGCCATCTCCTCCGTTTCGGTCACCTCCATCCCGGTCACCTTCACCTTATCCCGACCAGATCCTTTATGTTTCGGTTTCTACCTTCTATCGGAAGAAGCGCGAAATCGATTCAACGAAGACCGTAACACTCTATGCGCCCTCGATTCCAAATTTATCTCACTCCTCTTTAGTTT...
Protein
Download Protein FASTA202 aa · TkA03G084740|TK1151|PROTEIN
IKSVKIRSDDRGQITFHYFKFTHTGHITIAISSVSVTSIPVTFTLSRPDPLCFGFYLLSEEARNRFNEDRNTLCALDSKFISLLFSFQDLHNQSSFNKSYPVTYPNEHTLYFSNCNPLSHITMDVRTELYNMDNNGTTRNYLSAGMTNLPRLYFIFSIIYLCFLWVWISVCFINSKCCKKFHLLMGAVFAMKAINLFCAAEL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G084740 |
|---|---|
| TK1151 ID | TkA03G084740 |
| OH-1004 ID | LXL04_004912 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 60.700 |
| Protein coverage (%) | TK1151 99.505 / OH-1004 45.662Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G084740 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:21565374-21565982 (-) | |||||||||
| Description | Similar to CAND7: Protein CANDIDATE G-PROTEIN COUPLED RECEPTOR 7 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002237 response to molecule of bacterial origin Biological Process GO:0007186 G protein-coupled receptor signaling pathway Biological Process GO:0010015 root morphogenesis Biological Process GO:0034122 negative regulation of toll-like receptor signaling pathway Biological Process GO:0050776 regulation of immune response Biological Process GO:0072583 clathrin-dependent endocytosis Biological Process GO:0072659 protein localization to plasma membrane Biological Process GO:2001008 positive regulation of cellulose biosynthetic process Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005769 early endosome Cellular Component GO:0005794 Golgi apparatus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT5G02630 ath:AT5G18520 hsa:56927 mmu:277463 rno:311857 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF21904CAND6-7_N2-131 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G084740 | PF21904 | CAND6-7_N | 2 | 131 | 8.1e-39 | 133.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.