TkA03G084520 | RubberDandelionOmics

Gene overview

TkA03G084520

Reference: TK1151 Chr: Chr03 Coordinates: 21524530-21524841 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · TkA03G084520|TK1151|cDNA

ATGGAAAAACAAGAAGTCGATCATAATAAAGTCAGTGTTAGTATTGTTGGAGAAAAGAAAGTGGAATTTCCACCACATGCAGCTGGTCAAAGTCAAGAATATGAAAGGTCAACGCCAGAATCAGTCACTGACTTTAGGCCTACAACACCAGGTAACAGTCCAGGAGCAGGCCATTCATTCGTGGAGCATAGCGCACCTACTGTACCAGAGTCTGGTTCAGGAAGCAGTGATGATTTTAGACCAACTGGACCTGGGCATAG...

CDS

Download CDS FASTA

312 bp · TkA03G084520|TK1151|CDS

ATGGAAAAACAAGAAGTCGATCATAATAAAGTCAGTGTTAGTATTGTTGGAGAAAAGAAAGTGGAATTTCCACCACATGCAGCTGGTCAAAGTCAAGAATATGAAAGGTCAACGCCAGAATCAGTCACTGACTTTAGGCCTACAACACCAGGTAACAGTCCAGGAGCAGGCCATTCATTCGTGGAGCATAGCGCACCTACTGTACCAGAGTCTGGTTCAGGAAGCAGTGATGATTTTAGACCAACTGGACCTGGGCATAG...

Protein

Download Protein FASTA

103 aa · TkA03G084520|TK1151|PROTEIN

MEKQEVDHNKVSVSIVGEKKVEFPPHAAGQSQEYERSTPESVTDFRPTTPGNSPGAGHSFVEHSAPTVPESGSGSSDDFRPTGPGHSPGGGHSKDGHIATPNA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G084520`
TK1151 ID	TkA03G084520
OH-1004 ID	LXL04_006870
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 76.866 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G084520`
Location	Chr03:21524530-21524841 (+)
Description	Similar to CEP6: Precursor of CEP6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006870` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006970 response to osmotic stress Biological Process GO:0006995 cellular response to nitrogen starvation Biological Process GO:0009733 response to auxin Biological Process GO:0035864 response to potassium ion Biological Process GO:0048364 root development Biological Process GO:0060359 response to ammonium ion Biological Process GO:1901371 regulation of leaf morphogenesis Biological Process GO:1901698 response to nitrogen compound Biological Process GO:1902025 nitrate import Biological Process GO:2000023 regulation of lateral root development Biological Process GO:2000280 regulation of root development Biological Process GO:0005576 extracellular region Cellular Component
KEGG gene cross-reference	ath:AT3G50610 ath:AT5G66816 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.903

Rank 1 · TkA03G084520 · TK1151

Cytoplasm0.049

Rank 2 · TkA03G084520 · TK1151

Endoplasmic reticulum0.038

Rank 3 · TkA03G084520 · TK1151

Cell membrane0.029

Rank 4 · TkA03G084520 · TK1151

Nucleus0.017

Rank 5 · TkA03G084520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30920CEP_precursor11-63 aa

PF30920CEP_precursor65-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G084520	`PF30920`	CEP_precursor	11	63	3.9e-18	66.5
TkA03G084520	`PF30920`	CEP_precursor	65	93	3.9e-18	66.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card