TkA03G084500 | RubberDandelionOmics

Gene overview

TkA03G084500

Reference: TK1151 Chr: Chr03 Coordinates: 21517326-21517643 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

318 bp · TkA03G084500|TK1151|cDNA

ATGGATCAAACTAAGTTAATCCTGGCCTTTTTGACCGTCACTCTTATCATCAACCTTCAGTGTGTTGAAGGTAGGCATCTTAAAACCACCAATCCGGCAAAAACAATTGCAAAAAGTGGTATACATGAATTACCAGCGGCATATGTAAATGCAAATGCTAATGAAGATCGACTTACAAAACCTTTGTCACCAACACCACCAAGTGAAACTTTAGTTGGGTCACAAACGTTGGTGCCACCCCCACCACATGGCGTTGAAGA...

CDS

Download CDS FASTA

318 bp · TkA03G084500|TK1151|CDS

ATGGATCAAACTAAGTTAATCCTGGCCTTTTTGACCGTCACTCTTATCATCAACCTTCAGTGTGTTGAAGGTAGGCATCTTAAAACCACCAATCCGGCAAAAACAATTGCAAAAAGTGGTATACATGAATTACCAGCGGCATATGTAAATGCAAATGCTAATGAAGATCGACTTACAAAACCTTTGTCACCAACACCACCAAGTGAAACTTTAGTTGGGTCACAAACGTTGGTGCCACCCCCACCACATGGCGTTGAAGA...

Protein

Download Protein FASTA

105 aa · TkA03G084500|TK1151|PROTEIN

MDQTKLILAFLTVTLIINLQCVEGRHLKTTNPAKTIAKSGIHELPAAYVNANANEDRLTKPLSPTPPSETLVGSQTLVPPPPHGVEDFRPTTPGHSPGAGHSLHN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G084500`
TK1151 ID	TkA03G084500
OH-1004 ID	LXL04_006869
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G084500

Location Chr03:21517326-21517643 (+)

Description Similar to CEP3: Precursor of CEP3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23440`	Extracellular signaling peptide that represses primary root growth rate and significantly inhibits lateral root formation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006869 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009630 gravitropism Biological Process

GO:0009642 response to light intensity Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010037 response to carbon dioxide Biological Process

KEGG gene cross-reference

ath:AT2G23440

ath:AT5G66815

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.817

Rank 1 · TkA03G084500 · TK1151

Endoplasmic reticulum0.101

Rank 2 · TkA03G084500 · TK1151

Cell membrane0.084

Rank 3 · TkA03G084500 · TK1151

Cytoplasm0.043

Rank 4 · TkA03G084500 · TK1151

Golgi apparatus0.029

Rank 5 · TkA03G084500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30920CEP_precursor8-102 aa

PF27785DNAI3_N10-42 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G084500	`PF30920`	CEP_precursor	8	102	5.8e-13	49.9
TkA03G084500	`PF27785`	DNAI3_N	10	42	0.17	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80460`	Arabidopsis thaliana	sp\|O80460\|PCEP3_ARATH Precursor of CEP3	59.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card