TkA03G081240 | RubberDandelionOmics

Gene overview

TkA03G081240

Reference: TK1151 Chr: Chr03 Coordinates: 20729111-20732090 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1930 bp · TkA03G081240|TK1151|cDNA

TTTGATCTACTTCTGGTCCCTTCCATCACCTTTTTCCCTATTTTCCCCTTCTTCCTTCGATCGAACCCTCCACCGTCTCCAACACTCTCACTTATGGCAGCTCTGGTGGCCGGTGGCCATTCCGATCCCTATCTTTCTGACGACGATTTAAGCAACCCCAGTTCTTCAGAAGACAACAATGCTATCGATCACTACATGAACACCTCGAATACTCAGTCTACCGATCCAGATGATCCTTCATCGTCTAAACGAAGAAAGTC...

CDS

Download CDS FASTA

1536 bp · TkA03G081240|TK1151|CDS

TTTGATCTACTTCTGGTCCCTTCCATCACCTTTTTCCCTATTTTCCCCTTCTTCCTTCGATCGAACCCTCCACCGTCTCCAACACTCTCACTTATGGCAGCTCTGGTGGCCGGTGGCCATTCCGATCCCTATCTTTCTGACGACGATTTAAGCAACCCCAGTTCTTCAGAAGACAACAATGCTATCGATCACTACATGAACACCTCGAATACTCAGTCTACCGATCCAGATGATCCTTCATCGTCTAAACGAAGAAAGTC...

Protein

Download Protein FASTA

511 aa · TkA03G081240|TK1151|PROTEIN

FDLLLVPSITFFPIFPFFLRSNPPPSPTLSLMAALVAGGHSDPYLSDDDLSNPSSSEDNNAIDHYMNTSNTQSTDPDDPSSSKRRKSKPVRFGMFGADIQNENRAPKLKLVVRKTSGKLLSMKRLRSKAKALKAPVPPSPAMIRAEEFQASLGTDFPSCVKVMVRTQVCYGFWMGLPLPFCRSFMPKEDVIFTLEDVNGGQWEVKYLAQKNVLSAGWKVFVVAHNLIEGDVLVFHLIEPLKFKIYILKQSESNELVDGAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G081240`
TK1151 ID	TkA03G081240
OH-1004 ID	LXL04_006853
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.217 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G081240

Location Chr03:20729111-20732090 (-)

Description Similar to Os01g0234100: B3 domain-containing protein Os01g0234100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19184`	B3 domain-containing protein At3g19184.	No verified direct reference in this release
`At5g42700`	B3 domain-containing protein At5g42700.	No verified direct reference in this release
`At5g58280`	Putative B3 domain-containing protein At5g58280.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0194400`	B3 domain-containing protein Os06g0194400.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006853 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G19184

dosa:Os01g0234100

dosa:Os03g0184500

dosa:Os05g0481400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · TkA03G081240 · TK1151

Cytoplasm0.089

Rank 2 · TkA03G081240 · TK1151

Cell membrane0.023

Rank 3 · TkA03G081240 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA03G081240 · TK1151

Plastid0.010

Rank 5 · TkA03G081240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B3160-247 aa

PF05266DUF724386-483 aa

PF16544STAR_dimer461-477 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G081240	`PF02362`	B3	160	247	1.3e-16	61.1
TkA03G081240	`PF05266`	DUF724	386	483	0.15	12.6
TkA03G081240	`PF16544`	STAR_dimer	461	477	0.29	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1G3M3`	Arabidopsis thaliana	sp\|Q1G3M3\|Y3918_ARATH B3 domain-containing protein At3g19184	48.700%	Swiss-Prot	Low
`Q9FMZ4`	Arabidopsis thaliana	sp\|Q9FMZ4\|Y5270_ARATH B3 domain-containing protein At5g42700	47.400%	Swiss-Prot	Low
`Q9FHB2`	Arabidopsis thaliana	sp\|Q9FHB2\|Y5828_ARATH Putative B3 domain-containing protein At5g58280	44.700%	Swiss-Prot	Low
`Q69V36`	Oryza sativa subsp. japonica	sp\|Q69V36\|Y6944_ORYSJ B3 domain-containing protein Os06g0194400	42.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card