TkA03G080370 | RubberDandelionOmics

Gene overview

TkA03G080370

Reference: TK1151 Chr: Chr03 Coordinates: 20508893-20509318 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

396 bp · TkA03G080370|TK1151|cDNA

ATGATGTCGCTCTGTGAACAACCAATGGAAGTATGTCAGGTCTGTAGAATCGACGGTTGCTTGGGGTGCGATTATTTCCGGCAAAATAAACAATGCGACGGCGTGGAGACGAAGCGGAAGAGGAAGCGACAGTATAGGGGAGTACGGCAGAGGCAATGGGGGACATGGGCGGCGGAAATTCGGGATCCGTTTAAGAAAGTGAGAGTGTGGTTGGGGACGTTTGGATCGGCGGAGCAAGCCGCGAGAGCTTACGACAGAGC...

CDS

Download CDS FASTA

396 bp · TkA03G080370|TK1151|CDS

ATGATGTCGCTCTGTGAACAACCAATGGAAGTATGTCAGGTCTGTAGAATCGACGGTTGCTTGGGGTGCGATTATTTCCGGCAAAATAAACAATGCGACGGCGTGGAGACGAAGCGGAAGAGGAAGCGACAGTATAGGGGAGTACGGCAGAGGCAATGGGGGACATGGGCGGCGGAAATTCGGGATCCGTTTAAGAAAGTGAGAGTGTGGTTGGGGACGTTTGGATCGGCGGAGCAAGCCGCGAGAGCTTACGACAGAGC...

Protein

Download Protein FASTA

131 aa · TkA03G080370|TK1151|PROTEIN

MMSLCEQPMEVCQVCRIDGCLGCDYFRQNKQCDGVETKRKRKRQYRGVRQRQWGTWAAEIRDPFKKVRVWLGTFGSAEQAARAYDRAAVHFRGDKAKTNFPASDYMEQRPVKIEQEDGKCSKSSMSAPKKN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G080370`
TK1151 ID	TkA03G080370
OH-1004 ID	LXL04_006848
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.900
Protein coverage (%)	TK1151 100.000 / OH-1004 70.149 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G080370

Location Chr03:20508893-20509318 (+)

Description Similar to ERF109: Ethylene-responsive transcription factor ERF109

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34410`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g50080`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g64750`	Negative regulator of the abscisic acid (ABA) signaling pathway involved in seed germination and in responses to stress conditions.	ABR1, an APETALA2-domain transcription factor that functions as a repressor of ABA response in Arabidopsis.2005 · DOI: 10.1104/pp.105.066324
`At2g47520`	Transcriptional activator that binds specifically to the cis- acting element GCC box 5'-AGCCGCC-3', or to the CRT/DRE element 5'- [AG]CCGAC-3'.	HRE1 and HRE2, two hypoxia-inducible ethylene response factors, affect anaerobic responses in Arabidopsis thaliana.2010 · DOI: 10.1111/j.1365-313x.2010.04149.x The hypoxia responsive transcription factor genes ERF71/HRE2 and ERF73/HRE1 of Arabidopsis are differentially regulated by ethylene.2011 · DOI: 10.1111/j.1399-3054.2011.01486.x AtERF71/HRE2 transcription factor mediates osmotic stress response as well as hypoxia response in Arabidopsis.2011 · DOI: 10.1016/j.bbrc.2011.09.039 Homeostatic response to hypoxia is regulated by the N-end rule pathway in plants.2011 · DOI: 10.1038/nature10534 Arabidopsis AtERF71/HRE2 functions as transcriptional activator via cis-acting GCC box or DRE/CRT element and is involved in root development through regulation of root cell expansion.2015 · DOI: 10.1007/s00299-014-1701-9 Hypoxia and the group VII ethylene response transcription factor HRE2 promote adventitious root elongation in Arabidopsis.2019 · DOI: 10.1111/plb.12873 The possible roles of AtERF71 in the defense response against the Fusarium graminearum .2018 · DOI: 10.5511/plantbiotechnology.18.0501b
`At1g43160`	Transcriptional activator involved in the regulation of plant development and tolerance to abiotic stresses.	Functional characterization of four APETALA2-family genes (RAP2.6, RAP2.6L, DREB19 and DREB26) in Arabidopsis.2011 · DOI: 10.1007/s11103-010-9711-7

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006848 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

KEGG gene cross-reference

ath:AT2G33710

ath:AT2G47520

ath:AT4G34410

ath:AT5G13330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.931

Rank 1 · TkA03G080370 · TK1151

Cytoplasm0.110

Rank 2 · TkA03G080370 · TK1151

Cell membrane0.025

Rank 3 · TkA03G080370 · TK1151

Plastid0.018

Rank 4 · TkA03G080370 · TK1151

Endoplasmic reticulum0.017

Rank 5 · TkA03G080370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP244-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G080370	`PF00847`	AP2	44	88	6.1e-12	46.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ06`	Arabidopsis thaliana	sp\|Q9SZ06\|EF109_ARATH Ethylene-responsive transcription factor ERF109	47.200%	Swiss-Prot	Medium
`Q70II3`	Arabidopsis thaliana	sp\|Q70II3\|EF110_ARATH Ethylene-responsive transcription factor ERF110	71.200%	Swiss-Prot	Medium
`Q9FGF8`	Arabidopsis thaliana	sp\|Q9FGF8\|ABR1_ARATH Ethylene-responsive transcription factor ABR1	76.700%	Swiss-Prot	Low
`O22259`	Arabidopsis thaliana	sp\|O22259\|ERF71_ARATH Ethylene-responsive transcription factor ERF071	64.000%	Swiss-Prot	Medium
`Q7G1L2`	Arabidopsis thaliana	sp\|Q7G1L2\|RAP26_ARATH Ethylene-responsive transcription factor RAP2-6	73.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card