TkA03G079650 | RubberDandelionOmics

Gene overview

TkA03G079650

Reference: TK1151 Chr: Chr03 Coordinates: 20278202-20278723 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

522 bp · TkA03G079650|TK1151|cDNA

TTGAAAAACACCAGTAAAAGAGTCGGAATACCTCATTCGCATCCACAAATCCCTCCGCTTTCACCTTCCTCACAGATCCCCGTCGGCAATTATCAGCAAACGGAGACTTCACACAGATCAAACAGTGACATTCCATTCGGATTCTCAACAATCCTACAATCATCACCGCCATTAATCCCATCAAGAGGATCAAAAGCCATGGAAGTAAAACGTGAATCAAATTGGGACAAAAACGTCGGTGTAACTGAAACCAAAATTGG...

CDS

Download CDS FASTA

522 bp · TkA03G079650|TK1151|CDS

TTGAAAAACACCAGTAAAAGAGTCGGAATACCTCATTCGCATCCACAAATCCCTCCGCTTTCACCTTCCTCACAGATCCCCGTCGGCAATTATCAGCAAACGGAGACTTCACACAGATCAAACAGTGACATTCCATTCGGATTCTCAACAATCCTACAATCATCACCGCCATTAATCCCATCAAGAGGATCAAAAGCCATGGAAGTAAAACGTGAATCAAATTGGGACAAAAACGTCGGTGTAACTGAAACCAAAATTGG...

Protein

Download Protein FASTA

173 aa · TkA03G079650|TK1151|PROTEIN

LKNTSKRVGIPHSHPQIPPLSPSSQIPVGNYQQTETSHRSNSDIPFGFSTILQSSPPLIPSRGSKAMEVKRESNWDKNVGVTETKIGDRKSEGEVVYDFFSTYINLNNLGRLNSFRSETCEDLNSNTKPNGGDTSDNEATSSTNIHKLGPTLLIDKKEGVKRSAGGIRMFIHM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G079650`
TK1151 ID	TkA03G079650
OH-1004 ID	LXL04_028394
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.900
Protein coverage (%)	TK1151 93.064 / OH-1004 69.869 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G079650

Location Chr03:20278202-20278723 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21230`	Transcription factor that acts as a repressor of reproductive development, meristem size and plant growth.	Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.2016 · DOI: 10.1111/tpj.13264

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028394 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0090567 reproductive shoot system development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G21230

ath:AT4G38900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.450

Rank 1 · TkA03G079650 · TK1151

Cytoplasm0.396

Rank 2 · TkA03G079650 · TK1151

Cell membrane0.103

Rank 3 · TkA03G079650 · TK1151

Mitochondrion0.062

Rank 4 · TkA03G079650 · TK1151

Golgi apparatus0.052

Rank 5 · TkA03G079650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIG8`	Arabidopsis thaliana	sp\|Q9SIG8\|BZP30_ARATH bZIP transcription factor 30	35.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card