TkA03G078940 | RubberDandelionOmics

Gene overview

TkA03G078940

Reference: TK1151 Chr: Chr03 Coordinates: 20110296-20113647 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3111 bp · TkA03G078940|TK1151|cDNA

TAAAATCGAAATTTTCGAAAAACTTAGTGACTTATTTAAAATTTGCCCTAACGAATATACAAAAAGAAACTAAAAGTATATCTAGGAAGAAATGATTATATCCGATGATTGGACACATAATTGGAGTTGTTAAGTAATTTCGTCTCAAGCTTGAAGGCTTGGATATTCCTTTCGAGCGAATTCTGTCGTGAATCGTTAGTTCGGTTACAAGACTTTATTTTGGCTTGATGATTGGACTGGGGAAGGCACATTCGCCTCTC...

CDS

Download CDS FASTA

1701 bp · TkA03G078940|TK1151|CDS

ATGGCTAAGATTAGTGACAAAATAACACAATTAAGGTGGTTTTATGGATCTTCATTGACCACAACTTTTACAGGGAAGTCTCTAGTTCCCATCCTCAAAACCACCATCAAACTAAAACCTCCATTACTCCCCTTTCCAAGAACTCAAGTCTTCCATCGTTGTTCTTGCAGATCAATCATGAAATCAAACGGATCATCACCCGTCACAGTAAAACAAACCATCGATCCAACCGACAAAGAACAGCAAATATTCGATCAATT...

Protein

Download Protein FASTA

566 aa · TkA03G078940|TK1151|PROTEIN

MAKISDKITQLRWFYGSSLTTTFTGKSLVPILKTTIKLKPPLLPFPRTQVFHRCSCRSIMKSNGSSPVTVKQTIDPTDKEQQIFDQLRKVLAHFNLQTQLRVAGGWVRDKLLGKECYDIDIALDDMLGKEFCEKVNEYLVSTGQQSQGIGVIQSNPDQSKHLETARMRLFDVWIDFVNLRSEDYTENSRIPTMQFGSPIQDAYRRDLTINSLFYNINTCKVEDFTKRGLDDLKSGKIVTPLPPKETFLDDPLRVLRAIRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G078940`
TK1151 ID	TkA03G078940
OH-1004 ID	LXL04_013877
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	32.900
Protein coverage (%)	TK1151 13.428 / OH-1004 10.067 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G078940`
Location	Chr03:20110296-20113647 (-)
Description	Similar to pcnB: Poly(A) polymerase I (Escherichia coli (strain K12)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013877` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006276 plasmid maintenance Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0009451 RNA modification Biological Process GO:0042780 tRNA 3'-end processing Biological Process GO:0043633 polyadenylation-dependent RNA catabolic process Biological Process GO:0071047 polyadenylation-dependent mRNA catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0003723 RNA binding Molecular Function GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	ecc:c0176 ece:Z0154 ecj:JW5808 eco:b0143 ecs:ECs_0147 stm:STM0184 stt:t0192 sty:STY0209 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.457

Rank 1 · TkA03G078940 · TK1151

Plastid0.357

Rank 2 · TkA03G078940 · TK1151

Nucleus0.173

Rank 3 · TkA03G078940 · TK1151

Cytoplasm0.155

Rank 4 · TkA03G078940 · TK1151

Peroxisome0.027

Rank 5 · TkA03G078940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26128Gad287-185 aa

PF01743PolyA_pol100-237 aa

PF12627PolyA_pol_RNAbd288-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G078940	`PF26128`	Gad2	87	185	0.036	14.8
TkA03G078940	`PF01743`	PolyA_pol	100	237	1.3e-31	110.3
TkA03G078940	`PF12627`	PolyA_pol_RNAbd	288	324	0.23	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card