TkA03G074270 | RubberDandelionOmics

Gene overview

TkA03G074270

Reference: TK1151 Chr: Chr03 Coordinates: 19054448-19057785 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1466 bp · TkA03G074270|TK1151|cDNA

CTTATTTGTTGATAAAATTGCGCAGGAATATCCACTCGTGTTGTATCGATATGATCACCGGGCAGACCAGCCCATACGTATCACCAGGCGTCGCGTCACACCTCTTCGCCTCTACCAACCCTCGAAGACATTCGCCATATCTGTTCCGGCGACGGTGAATCGTCGCGAATCAGCTCCACCGGAGGCCGGCCAAATAACTACGTGTCTTGATACCTTGCTTTACGAAGGAAGGAACAAATGGCGTACTCCTCTTCTACTCA...

CDS

Download CDS FASTA

849 bp · TkA03G074270|TK1151|CDS

ATGTTTTCTTGCAAAACAAGTCACCATAATTTGTATAAAATTGAGAGATGTGTGATAGTTAGATCGGGAATTGCTGGAACTGGATCCCCTTCAACTGCATATCATTTGCCAGAATTTCAAGTAATTTCAAAAGTTAGAGGAGTTTGCTTTTATGCTGTTACATCCACCATTGCCATATTCTTAATTATGTCAATGATAATAGCACATCCATTTGTGCTCTTAAAAGATCAATACCAAAGAACCTATCATCATTTTATTGC...

Protein

Download Protein FASTA

282 aa · TkA03G074270|TK1151|PROTEIN

MFSCKTSHHNLYKIERCVIVRSGIAGTGSPSTAYHLPEFQVISKVRGVCFYAVTSTIAIFLIMSMIIAHPFVLLKDQYQRTYHHFIAKIWASMTLYPFMKLKIQGLENLPPKNSPAVYVSNHQSFLDIYALLTLGRNLKFISKTAIFLFPVVGWAMFLMGVIPLKRMDSRSQLQTLKRCMELVKNGGSVFFFPEGTRSKDGRLGTFKKGAFSIAAKTKVPVVPITLIGTGKIMPAGMESILNPGSVKVIIHPPVQGDNPD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G074270`
TK1151 ID	TkA03G074270
OH-1004 ID	LXL04_016217
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	31.200
Protein coverage (%)	TK1151 48.227 / OH-1004 28.364 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G074270

Location Chr03:19054448-19057785 (-)

Description Similar to TAZ: Tafazzin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30580`	Plastidial enzyme of the prokaryotic glycerol-3-phosphate pathway that converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at position sn-2.	Plastid lysophosphatidyl acyltransferase is essential for embryo development in Arabidopsis.2004 · DOI: 10.1104/pp.103.035832

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016217 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007007 inner mitochondrial membrane organization Biological Process

GO:0032048 cardiolipin metabolic process Biological Process

GO:0035965 cardiolipin acyl-chain remodeling Biological Process

GO:0042407 cristae formation Biological Process

GO:0045823 positive regulation of heart contraction Biological Process

GO:0046471 phosphatidylglycerol metabolic process Biological Process

GO:1900210 positive regulation of cardiolipin metabolic process Biological Process

GO:2001171 positive regulation of ATP biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

KEGG gene cross-reference

dre:321965

ggo:101147380

mmu:66826

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.315

Rank 1 · TkA03G074270 · TK1151

Plastid0.276

Rank 2 · TkA03G074270 · TK1151

Endoplasmic reticulum0.196

Rank 3 · TkA03G074270 · TK1151

Golgi apparatus0.051

Rank 4 · TkA03G074270 · TK1151

Cytoplasm0.049

Rank 5 · TkA03G074270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06697DUF119114-55 aa

PF01553Acyltransferase101-226 aa

PF06697DUF1191175-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G074270	`PF06697`	DUF1191	14	55	0.15	12.5
TkA03G074270	`PF01553`	Acyltransferase	101	226	2.6e-33	115.4
TkA03G074270	`PF06697`	DUF1191	175	190	0.15	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXU8`	Arabidopsis thaliana	sp\|Q8GXU8\|LPAT1_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase LPAT1, chloroplastic	61.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card