TkA03G068720 | RubberDandelionOmics

Gene overview

TkA03G068720

Reference: TK1151 Chr: Chr03 Coordinates: 17712252-17723002 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4444 bp · TkA03G068720|TK1151|cDNA

ATACCGATTTCAAAGATTATTTGAAATCTGAAAAAATTCGTATACGTAAGTATAGGAATACTTGGATTTCTGAAAAGATTATTTGGTCATCCAGCAAAATTGAACTGTTTTCCACAATTGTCGTAGCCTTTGACCCTATAAGCCTGACCTCCTCCTCTCTTTTCCTGGTATATAGGCAAATCCCCCATTGCCCATTATGCCTCCTACCATCAATCCCATCTTCGCTGCCACCGCACCAGCAAAGTTGGCAATAAAATCAA...

CDS

Download CDS FASTA

486 bp · TkA03G068720|TK1151|CDS

ATGCTAGACTTGTGCTTGAAGATGGATCCATTTGGAAAGCCAAATCATTTGGTGCTTCTGGGACTCAAGTTGGTGAAGTTATTTAACACTTCATTAACAGGGTACCAAGAAATTCTTACAGACCCAAGCTATGCAGGCCAATTTGTCCTTATGACAAACCCACATATTGGCAATACTGGAGTGAATATTGATGATGAAGAATCAGTCAAGTGCTTTCTTGCTGGTTTGGTAATTAGAAGTTTGAGTATCAGCACTTCAAA...

Protein

Download Protein FASTA

161 aa · TkA03G068720|TK1151|PROTEIN

MLDLCLKMDPFGKPNHLVLLGLKLVKLFNTSLTGYQEILTDPSYAGQFVLMTNPHIGNTGVNIDDEESVKCFLAGLVIRSLSISTSNWRCTESLSDYLSKRNIMGIYDVDTRAITRRLREDGSLIGVLSTEKSKTDEELLEMSRNWDIVGNGLFYLGNLEP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G068720`
TK1151 ID	TkA03G068720
OH-1004 ID	LXL04_006793
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 77.019 / OH-1004 29.454 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G068720

Location Chr03:17712252-17723002 (-)

Description Similar to CARA: Carbamoyl-phosphate synthase small chain, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27740`	Small subunit of the arginine-specific carbamoyl phosphate synthase (CPSase).	Analysis of ven3 and ven6 reticulate mutants reveals the importance of arginine biosynthesis in Arabidopsis leaf development.2011 · DOI: 10.1111/j.1365-313x.2010.04425.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0708100`	Small subunit of the arginine-specific carbamoyl phosphate synthase (CPSase).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006793 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process Biological Process

GO:0006526 L-arginine biosynthetic process Biological Process

GO:0006541 glutamine metabolic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0044205 'de novo' UMP biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005951 carbamoyl-phosphate synthase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004088 carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity Molecular Function

GO:0004359 glutaminase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ana:alr1155

ath:AT3G27740

dosa:Os02g0708100

syc:syc1970_d

syn:sll1498

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529

Rank 1 · TkA03G068720 · TK1151

Nucleus0.279

Rank 2 · TkA03G068720 · TK1151

Mitochondrion0.140

Rank 3 · TkA03G068720 · TK1151

Endoplasmic reticulum0.110

Rank 4 · TkA03G068720 · TK1151

Cell membrane0.080

Rank 5 · TkA03G068720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00988CPSase_sm_chain27-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G068720	`PF00988`	CPSase_sm_chain	27	127	1.9e-39	135.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVW7`	Arabidopsis thaliana	sp\|Q9LVW7\|CARA_ARATH Carbamoyl phosphate synthase small chain, chloroplastic	78.000%	Swiss-Prot	High
`Q6YV23`	Oryza sativa subsp. japonica	sp\|Q6YV23\|CARA_ORYSJ Carbamoyl phosphate synthase small chain, chloroplastic	85.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card