TkA03G058440 | RubberDandelionOmics

Gene overview

TkA03G058440

Reference: TK1151 Chr: Chr03 Coordinates: 15056423-15057321 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

562 bp · TkA03G058440|TK1151|cDNA

ATCAGTCTCTCTAATCCTATACACCCTAAACACACACATACGGGGACATCCATGGATGTGTATATAGTCTTGCAAGAAGCAGGGATTGCCAAATACGTTATGTATTTATGTTTTGTTTTATGTTCCATTCAAAACACCGTGCTATATCTTTTTCGTTTCACGAGCATCTTTGAGTCGGATGATACCTGGCATCACAATCATCAAGATCCGTCTGATGGCCCTCCTCTTTCAGCGGTGCTAACTCGTGAATTCCTTGTGGT...

CDS

Download CDS FASTA

477 bp · TkA03G058440|TK1151|CDS

ATGGATGTGTATATAGTCTTGCAAGAAGCAGGGATTGCCAAATACGTTATGTATTTATGTTTTGTTTTATGTTCCATTCAAAACACCGTGCTATATCTTTTTCGTTTCACGAGCATCTTTGAGTCGGATGATACCTGGCATCACAATCATCAAGATCCGTCTGATGGCCCTCCTCTTTCAGCGGTGCTAACTCGTGAATTCCTTGTGGTCACAAACTATAAGGACATTCACAGAATGGATTTGCCGGAAAGTTGTGCAGT...

Protein

Download Protein FASTA

158 aa · TkA03G058440|TK1151|PROTEIN

MDVYIVLQEAGIAKYVMYLCFVLCSIQNTVLYLFRFTSIFESDDTWHHNHQDPSDGPPLSAVLTREFLVVTNYKDIHRMDLPESCAVCLDEFGRDDKTRCLKNCMHIFHQGCLDSWMDHAHDTCPICRTSLLPNAYQNEYKKRFKGVAFGLTPIQGRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G058440`
TK1151 ID	TkA03G058440
OH-1004 ID	LXL04_006696
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.600
Protein coverage (%)	TK1151 100.000 / OH-1004 79.798 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G058440

Location Chr03:15056423-15057321 (-)

Description Similar to BRH1: Brassinosteroid-responsive RING protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46650`	RING-H2 finger protein ATL30.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006696 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010200 response to chitin Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0047484 regulation of response to osmotic stress Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1901371 regulation of leaf morphogenesis Biological Process

GO:1905421 regulation of plant organ morphogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G23980

ath:AT2G01150

ath:AT3G61460

ath:AT4G11360

ath:AT4G11370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.301

Rank 1 · TkA03G058440 · TK1151

Endoplasmic reticulum0.270

Rank 2 · TkA03G058440 · TK1151

Cytoplasm0.231

Rank 3 · TkA03G058440 · TK1151

Golgi apparatus0.202

Rank 4 · TkA03G058440 · TK1151

Cell membrane0.195

Rank 5 · TkA03G058440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23555zf-RING_Vps4119-28 aa

PF12861zf-ANAPC1176-130 aa

PF12678zf-rbx178-128 aa

PF22795DUF4796_N79-91 aa

PF21349RUBY_RBDX80-88 aa

PF13920zf-C3HC4_383-130 aa

PF13639zf-RING_284-128 aa

PF17120zf-RING_1684-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G058440	`PF23555`	zf-RING_Vps41	19	28	2.1	8.7
TkA03G058440	`PF12861`	zf-ANAPC11	76	130	5.1e-05	24.0
TkA03G058440	`PF12678`	zf-rbx1	78	128	2.6e-05	25.1
TkA03G058440	`PF22795`	DUF4796_N	79	91	0.021	15.4
TkA03G058440	`PF21349`	RUBY_RBDX	80	88	0.037	14.2
TkA03G058440	`PF13920`	zf-C3HC4_3	83	130	0.00072	20.0
TkA03G058440	`PF13639`	zf-RING_2	84	128	2.7e-12	47.4
TkA03G058440	`PF17120`	zf-RING_16	84	125	0.0041	17.4
TkA03G058440	`PF22908`	PHD_NSD	84	123	0.27	12.3
TkA03G058440	`PF17123`	zf-RING_11	85	113	1e-07	32.2
TkA03G058440	`PF14634`	zf-RING_5	85	129	5.6e-07	30.1
TkA03G058440	`PF00097`	zf-C3HC4	85	127	2.5e-06	28.0
TkA03G058440	`PF13923`	zf-C3HC4_2	85	127	3e-06	27.6
TkA03G058440	`PF13445`	zf-RING_UBOX	85	125	8.7e-06	26.4
TkA03G058440	`PF14447`	Prok-RING_4	85	130	0.048	14.3
TkA03G058440	`PF14835`	zf-RING_6	85	130	0.055	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIR0`	Arabidopsis thaliana	sp\|Q9FIR0\|ATL30_ARATH RING-H2 finger protein ATL30	34.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card