TkA03G047780 | RubberDandelionOmics

Gene overview

TkA03G047780

Reference: TK1151 Chr: Chr03 Coordinates: 12593086-12597481 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2556 bp · TkA03G047780|TK1151|cDNA

TTTCAAGAGCTTCGAAAAGGAAAGGCTACGCAATATAAGCAAAATATATATCATCTCTCTCCTCTCTTCTCTCTCTCTCTCTCTCTCTCCGATACATGGGAGAGAAAAGTCAATCGTCTATGAACAAATCTACGCAAGATTGCAGATTGATACATCTTTTATCTTCATAGATTCCTAGGTTTATAGATTTGTATCTGGTGTTTAAACCCCTAATTTCGCGCATTTGTTGAATGAAATCAACCTAATGCATTGGTGTTCCA...

CDS

Download CDS FASTA

852 bp · TkA03G047780|TK1151|CDS

ATGCATTCGTGGTTTGCTTTGAATTCAGTGGCGCCTAGTATTGTGGAGGTGAAAGGGATTCATCATTTTGAGTGGCTGAATAGGGATAATGTTCCTGTTCTTGAAGCTATGGAGAATCATAAGGGGGTGAGGGATTATTATCATGGGAATCATGTGATGGGGGCGAATGTTAGTGTGACATCACCGAGGGTTTTTGCTTCAAAGTTGCAGGCCAGGAGTCCGAAATATATATCGTTGCTTAATCATATTCGCATATATTT...

Protein

Download Protein FASTA

283 aa · TkA03G047780|TK1151|PROTEIN

MHSWFALNSVAPSIVEVKGIHHFEWLNRDNVPVLEAMENHKGVRDYYHGNHVMGANVSVTSPRVFASKLQARSPKYISLLNHIRIYLPELFPNLDKVVFLDDDIVIQRDLSPLWDIDLGGKVNGAVETCKGEDPWVMGKRFKIYFNFSNPLVAKSLDPEECAWAFGMNIFDLKAWRLTDIRETYHLWLKENLNSNLTLWKLGTLPPALIAFRGHIQPIDQSWHMLGLGYQKNTSLQTLKKAAVIHYNGQSKPWLEIGFDH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G047780`
TK1151 ID	TkA03G047780
OH-1004 ID	LXL04_006553
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 53.195 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G047780

Location Chr03:12593086-12597481 (+)

Description Similar to GAUT14: Probable galacturonosyltransferase 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01040`	May be involved in pectin and/or xylans biosynthesis in cell walls (By similarity).	Arabidopsis galacturonosyltransferase (GAUT) 13 and GAUT14 have redundant functions in pollen tube growth.2013 · DOI: 10.1093/mp/sst084
`At5g15470`	May be involved in pectin and/or xylans biosynthesis in cell walls (By similarity).	Arabidopsis galacturonosyltransferase (GAUT) 13 and GAUT14 have redundant functions in pollen tube growth.2013 · DOI: 10.1093/mp/sst084
`At5g54690`	Involved in pectin assembly and/or distribution, and in the synthesis of secondary wall glucuronoxylan.	The Arabidopsis irregular xylem8 mutant is deficient in glucuronoxylan and homogalacturonan, which are essential for secondary cell wall integrity.2007 · DOI: 10.1105/tpc.106.047720 Arabidopsis irregular xylem8 and irregular xylem9: implications for the complexity of glucuronoxylan biosynthesis.2007 · DOI: 10.1105/tpc.106.049320 Comparison of five xylan synthesis mutants reveals new insight into the mechanisms of xylan synthesis.2007 · DOI: 10.1111/j.1365-313x.2007.03307.x
`At3g61130`	Involved in pectin biosynthesis.	Functional identification of an Arabidopsis pectin biosynthetic homogalacturonan galacturonosyltransferase.2006 · DOI: 10.1073/pnas.0600120103
`At4g38270`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006553 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010289 homogalacturonan biosynthetic process Biological Process

GO:0010413 glucuronoxylan metabolic process Biological Process

GO:0010417 glucuronoxylan biosynthetic process Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G01040

ath:AT3G58790

ath:AT3G61130

ath:AT5G15470

ath:AT5G54690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.685

Rank 1 · TkA03G047780 · TK1151

Endoplasmic reticulum0.146

Rank 2 · TkA03G047780 · TK1151

Cytoplasm0.081

Rank 3 · TkA03G047780 · TK1151

Extracellular0.064

Rank 4 · TkA03G047780 · TK1151

Cell membrane0.052

Rank 5 · TkA03G047780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01501Glyco_transf_89-256 aa

PF18404Glyco_transf_2484-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G047780	`PF01501`	Glyco_transf_8	9	256	4.4e-71	240.1
TkA03G047780	`PF18404`	Glyco_transf_24	84	132	1.4e-05	25.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WV13`	Arabidopsis thaliana	sp\|Q0WV13\|GAUTD_ARATH Probable galacturonosyltransferase 13	81.300%	Swiss-Prot	High
`Q8GWT1`	Arabidopsis thaliana	sp\|Q8GWT1\|GAUTE_ARATH Probable galacturonosyltransferase 14	80.600%	Swiss-Prot	High
`Q9FH36`	Arabidopsis thaliana	sp\|Q9FH36\|GAUTC_ARATH Probable galacturonosyltransferase 12	63.000%	Swiss-Prot	High
`Q9LE59`	Arabidopsis thaliana	sp\|Q9LE59\|GAUT1_ARATH Polygalacturonate 4-alpha-galacturonosyltransferase	46.300%	Swiss-Prot	Medium
`Q0WQD2`	Arabidopsis thaliana	sp\|Q0WQD2\|GAUT3_ARATH Probable galacturonosyltransferase 3	47.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card