TkA03G046620 | RubberDandelionOmics

Gene overview

TkA03G046620

Reference: TK1151 Chr: Chr03 Coordinates: 12298762-12301280 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1407 bp · TkA03G046620|TK1151|cDNA

GGAAAGCCACATGCAATTCTTGTACCTTACCCAGCTCAAGGTCATGTAATCCCCATGATGGAGCTCATGCAACGACTAGTCAAACAAGGAGTCAGAGTGACATTCGTCAATACTGATATCACTCACAAATTGGTTACAAACGCACTGTCTGAAGATGATAAGTTGAACGATTTAGCAAGTCTTGTGTCACTACCAGATGGTCTAGCAGCAGGGGACGTTAGAAACGATTTGGGTAAGTTAACCGATTCAATGTTTCGAGT...

CDS

Download CDS FASTA

1296 bp · TkA03G046620|TK1151|CDS

ATGATGGAGCTCATGCAACGACTAGTCAAACAAGGAGTCAGAGTGACATTCGTCAATACTGATATCACTCACAAATTGGTTACAAACGCACTGTCTGAAGATGATAAGTTGAACGATTTAGCAAGTCTTGTGTCACTACCAGATGGTCTAGCAGCAGGGGACGTTAGAAACGATTTGGGTAAGTTAACCGATTCAATGTTTCGAGTCATGCCTGTGAAGCTTGAAGAGCTTATTGAACAACTTAATGAAAATGATGGCGA...

Protein

Download Protein FASTA

431 aa · TkA03G046620|TK1151|PROTEIN

MMELMQRLVKQGVRVTFVNTDITHKLVTNALSEDDKLNDLASLVSLPDGLAAGDVRNDLGKLTDSMFRVMPVKLEELIEQLNENDGEKVTCIVADTCMGWAFGVGEKLKVKKVAFWPASGVVLASLICIPKLIEDGIIDKKGTLMKKQIVQLSPTMPAMSSSDFTWLSIGDKKTQQDLFDLMLKGNKFMKLAERIVCNSAYELETTTFNSFPEILPIGPLASNKVANQIGHFWKEDLTCLTWLDQQPVGSVIYVAFGSVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G046620`
TK1151 ID	TkA03G046620
OH-1004 ID	LXL04_006540
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 95.768 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G046620

Location Chr03:12298762-12301280 (+)

Description Similar to UGT83A1: UDP-glycosyltransferase 83A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02100`	UDP-glycosyltransferase 83A1.	No verified direct reference in this release
`At1g22400`	Involved in the O-glucosylation of trans-zeatin and dihydrozeatin.	N-glucosylation of cytokinins by glycosyltransferases of Arabidopsis thaliana.2004 · DOI: 10.1074/jbc.m409569200
`At3g22250`	UDP-glycosyltransferase 82A1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006540 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0015020 glucuronosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050057 linamarin synthase activity Molecular Function

GO:0050403 trans-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0050502 cis-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AEO45781

ag:AEO45782

ath:AT1G22400

ath:AT1G78270

ath:AT3G02100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.720

Rank 1 · TkA03G046620 · TK1151

Nucleus0.168

Rank 2 · TkA03G046620 · TK1151

Peroxisome0.080

Rank 3 · TkA03G046620 · TK1151

Endoplasmic reticulum0.079

Rank 4 · TkA03G046620 · TK1151

Mitochondrion0.046

Rank 5 · TkA03G046620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT4-132 aa

PF04410Gar119-91 aa

PF07881Fucose_iso_N155-99 aa

PF00201UDPGT234-391 aa

PF06722EryCIII-like_C303-391 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G046620	`PF00201`	UDPGT	4	132	2.9e-23	83.2
TkA03G046620	`PF04410`	Gar1	19	91	0.12	12.9
TkA03G046620	`PF07881`	Fucose_iso_N1	55	99	0.16	12.5
TkA03G046620	`PF00201`	UDPGT	234	391	2.9e-23	83.2
TkA03G046620	`PF06722`	EryCIII-like_C	303	391	0.2	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGA8`	Arabidopsis thaliana	sp\|Q9SGA8\|U83A1_ARATH UDP-glycosyltransferase 83A1	42.800%	Swiss-Prot	Medium
`Q9SK82`	Arabidopsis thaliana	sp\|Q9SK82\|U85A1_ARATH UDP-glycosyltransferase 85A1	32.000%	Swiss-Prot	Medium
`Q9LHJ2`	Arabidopsis thaliana	sp\|Q9LHJ2\|U82A1_ARATH UDP-glycosyltransferase 82A1	33.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card