TkA03G040300 | RubberDandelionOmics

Gene overview

TkA03G040300

Reference: TK1151 Chr: Chr03 Coordinates: 10619150-10627988 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

605 bp · TkA03G040300|TK1151|cDNA

AACCACCATGGTTTTCGATCAAACCACCTATCTTTTTCTCCTATAAACATACACCACCAATACGGAAACCAACTTCTGCTATCCAAACACCATTCCTCTTTGGTTACGATATTCAATTTCATGAATCATTTCCTTTTTTGGTTCATTTGATGAGACTGCCGCCAAGGGATTCTGATCCAGCTTTTTAGGTACTCACTAAGAACAAATTAAACAAGTTCTTCAAACGGCTGGAAATTAAAATGGGAAGAGGTCGAGTGCAA...

CDS

Download CDS FASTA

366 bp · TkA03G040300|TK1151|CDS

ATGGGAAGAGGTCGAGTGCAATTGAAGCGGATCGAGAACAAAATAAGTAGGCAAGTCACGTTCTCGAAACGAAGAACAGGATTATTGAAGAAAGCGCATGAGATCTCAGTTCTTTGTGATGCTCATGTTGCTCTCATCGTTTTCTCTTCAAGAGGAAAGTTGTTTGAATACTCTAATAACTCCAGCATGGAAGCAATTCTGGAACGATACGAACGATGTGCATATGCTGAGAAGCTTCTTACTGGACCAGAAACCGGAAC...

Protein

Download Protein FASTA

121 aa · TkA03G040300|TK1151|PROTEIN

MGRGRVQLKRIENKISRQVTFSKRRTGLLKKAHEISVLCDAHVALIVFSSRGKLFEYSNNSSMEAILERYERCAYAEKLLTGPETGTPGSWTLESSQLMAKVEVLEKTIRYVPISIKWYVG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G040300`
TK1151 ID	TkA03G040300
OH-1004 ID	LXL04_024199
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.500
Protein coverage (%)	TK1151 91.736 / OH-1004 45.492 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G040300

Location Chr03:10619150-10627988 (-)

Description Similar to FULL: Agamous-like MADS-box protein FUL-L

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69120`	Transcription factor that promotes early floral meristem identity in synergy with LEAFY.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024199 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009908 flower development Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0005634 nucleus Cellular Component

GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

sot:102577795

vvi:100232952

vvi:100232953

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · TkA03G040300 · TK1151

Cytoplasm0.115

Rank 2 · TkA03G040300 · TK1151

Cell membrane0.020

Rank 3 · TkA03G040300 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA03G040300 · TK1151

Plastid0.011

Rank 5 · TkA03G040300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319SRF-TF10-57 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G040300	`PF00319`	SRF-TF	10	57	6.3e-26	90.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P35631`	Arabidopsis thaliana	sp\|P35631\|AP1_ARATH Floral homeotic protein APETALA 1	69.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card