RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G039760
Reference: TK1151 Chr: Chr03 Coordinates: 10462116-10481756 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

15406 bp · TkA03G039760|TK1151|cDNA

TTTTAATCTTTTCATCTATCAAGTCCCACCGCCTCTATGGCTTGTCCACACTAATAAGCCCCTCCACTAAACTCTCTTTTGATTAAAGTATCTGTAAAACTGCACTGATAGATCAGTCACACACAAATACATTCATCATCGGTCCCCCGATCAATTTATCCGGCCATGGCTGAAGAAATCGCCAGACTGGTCGGAGTTCTCTTCGACGATAAGGCGTCGTCTTCGTCGAACGATATTAGACTTCGGTCTGAAAAGTTAGG...

CDS

Download CDS FASTA

15048 bp · TkA03G039760|TK1151|CDS

ATGGCTGAAGAAATCGCCAGACTGGTCGGAGTTCTCTTCGACGATAAGGCGTCGTCTTCGTCGAACGATATTAGACTTCGGTCTGAAAAGTTAGGGCTCCAAACGTTGTATTTGATCCTTAAACAAGGCGTTGAAATCAACAGTAATGGAAAATTAGGGCTACAACACTGGGACCAGGCTCAGATTCAAGCCGTTATTTCCGTAGCATACGCGATTGTCTCTTCAACCCGATCCATATCTGTCGAGCAAGTAGAGCCGAT...

Protein

Download Protein FASTA

5015 aa · TkA03G039760|TK1151|PROTEIN

MAEEIARLVGVLFDDKASSSSNDIRLRSEKLGLQTLYLILKQGVEINSNGKLGLQHWDQAQIQAVISVAYAIVSSTRSISVEQVEPIIVAVMEQSLEFALCCLEKSVATSDDISFIQLLEIALVDGTIKEADVSHPSTSLLTDSIKSIPLRTENVELQDHIECILQGNSCSKEKKPVDRLLMTLSSEWTQHDNINSWTTGRTSHDLNKFVPLLQHWAVVHLGCIHRLISYSTTLVQNLDRYDEKTDTITLRKRLSLCARI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G039760
TK1151 IDTkA03G039760
OH-1004 IDLXL04_006468
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.300
Protein coverage (%)TK1151 100.000 / OH-1004 98.091
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G039760
LocationChr03:10462116-10481756 (-)
DescriptionSimilar to BIG: Auxin transport protein BIG
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g02260 Required for auxin efflux and polar auxin transport (PAT) influencing auxin-mediated developmental responses (e.g. cell elongation, apical dominance, lateral root production, inflorescence architecture, general growth and development).
BIG: a calossin-like protein required for polar auxin transport in Arabidopsis.2001 · DOI: 10.1101/gad.905201
Mutations in the huge Arabidopsis gene BIG affect a range of hormone and light responses.2003 · DOI: 10.1046/j.1365-313x.2003.01779.x
The auxin transport inhibitor response 3 (tir3) allele of BIG and auxin transport inhibitors affect the gibberellin status of Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2004.02287.x
CRM1/BIG-mediated auxin action regulates Arabidopsis inflorescence development.2007 · DOI: 10.1093/pcp/pcm094
Arabidopsis mutants define downstream branches in the phototransduction pathway.1994 · DOI: 10.1101/gad.8.3.339
Reduced naphthylphthalamic acid binding in the tir3 mutant of Arabidopsis is associated with a reduction in polar auxin transport and diverse morphological defects.1997 · DOI: 10.1105/tpc.9.5.745

Rice

Reference gene IDPossible functionPapers / DOI
Os09g0247700 Required for auxin efflux and polar auxin transport (PAT) influencing auxin-mediated developmental responses (e.g. cell elongation, apical dominance, lateral root production, inflorescence architecture, general growth and development) (By similarity). No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_006468 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0007032 endosome organization Biological Process
GO:0009620 response to fungus Biological Process
GO:0009640 photomorphogenesis Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0009926 auxin polar transport Biological Process
GO:0010311 lateral root formation Biological Process
GO:0010508 positive regulation of autophagy Biological Process
KEGG gene cross-reference
ath:AT3G02260
dosa:Os09g0247700
hsa:23352
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.469
Rank 1 · TkA03G039760 · TK1151
Cytoplasm0.390
Rank 2 · TkA03G039760 · TK1151
Golgi apparatus0.095
Rank 3 · TkA03G039760 · TK1151
Cell membrane0.078
Rank 4 · TkA03G039760 · TK1151
Endoplasmic reticulum0.078
Rank 5 · TkA03G039760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30838UBR4_TPR1192-1256 aa
PF30802zf-UBR_11497-1553 aa
PF02207zf-UBR1509-1557 aa
PF00569ZZ1527-1539 aa
PF00569ZZ2570-2602 aa
PF02207zf-UBR2571-2601 aa
PF00569ZZ3434-3467 aa
PF02207zf-UBR3439-3467 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G039760PF30838UBR4_TPR119212561.3e-105353.8
TkA03G039760PF30802zf-UBR_1149715531.2e-0835.9
TkA03G039760PF02207zf-UBR150915577.7e-0523.4
TkA03G039760PF00569ZZ152715393.2e-0937.2
TkA03G039760PF00569ZZ257026023.2e-0937.2
TkA03G039760PF02207zf-UBR257126017.7e-0523.4
TkA03G039760PF00569ZZ343434673.2e-0937.2
TkA03G039760PF02207zf-UBR343934677.7e-0523.4
TkA03G039760PF30802zf-UBR_1344134511.2e-0835.9
TkA03G039760PF24079UBR4347235971.9e-34119.4
TkA03G039760PF30838UBR4_TPR398140901.3e-105353.8
TkA03G039760PF30837UBR4_Ub410042266.3e-48161.9
TkA03G039760PF30838UBR4_TPR424345851.3e-105353.8
TkA03G039760PF13764E3_UbLigase_R4464949891.4e-123412.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SRU2Arabidopsis thalianasp|Q9SRU2|BIG_ARATH Auxin transport protein BIG62.200%Swiss-ProtHigh
B9G2A8Oryza sativa subsp. japonicasp|B9G2A8|BIG_ORYSJ Auxin transport protein BIG57.800%Swiss-ProtHigh

JBrowse

View in Genome Browser