TkA03G037540 | RubberDandelionOmics

Gene overview

TkA03G037540

Reference: TK1151 Chr: Chr03 Coordinates: 9924440-9924799 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkA03G037540|TK1151|cDNA

ATGACACCACCAACAAACAACACCACCGCCGCCGTGTCGGCCACTGCAGCCGCCACCGGATTTCGGTGGAGCTCTCCAATTCCCTACCTGTTCGGTGGTTTGGCTTTGATGCTAATCCTCATAGCATGTGCATTGGTCATCTTAGTCTGCTCTTACAAGAAACCATATTCTTCTTCAAACTCGCTGGAAAACGCCACCGGCGATCAAGAAAAGACACCCACATCGGAGTTTCGTATTGAATTGTCGCCGGAAATGGAGCC...

CDS

Download CDS FASTA

360 bp · TkA03G037540|TK1151|CDS

ATGACACCACCAACAAACAACACCACCGCCGCCGTGTCGGCCACTGCAGCCGCCACCGGATTTCGGTGGAGCTCTCCAATTCCCTACCTGTTCGGTGGTTTGGCTTTGATGCTAATCCTCATAGCATGTGCATTGGTCATCTTAGTCTGCTCTTACAAGAAACCATATTCTTCTTCAAACTCGCTGGAAAACGCCACCGGCGATCAAGAAAAGACACCCACATCGGAGTTTCGTATTGAATTGTCGCCGGAAATGGAGCC...

Protein

Download Protein FASTA

119 aa · TkA03G037540|TK1151|PROTEIN

MTPPTNNTTAAVSATAAATGFRWSSPIPYLFGGLALMLILIACALVILVCSYKKPYSSSNSLENATGDQEKTPTSEFRIELSPEMEPKIVIVMPGHINPTYLAKPAPAAADVSDNLDQV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G037540`
TK1151 ID	TkA03G037540
OH-1004 ID	LXL04_006449
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G037540

Location Chr03:9924440-9924799 (+)

Description Similar to GDU2: Protein GLUTAMINE DUMPER 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24920`	Probable subunit of an amino acid transporter involved in the regulation of the amino acid metabolism.	No verified direct reference in this release
`At4g31730`	Probable subunit of an amino acid transporter involved in the regulation of the amino acid metabolism.	Overexpression of GLUTAMINE DUMPER1 leads to hypersecretion of glutamine from Hydathodes of Arabidopsis leaves.2004 · DOI: 10.1105/tpc.021642 The plant-specific VIMAG domain of Glutamine Dumper1 is necessary for the function of the protein in Arabidopsis.2006 · DOI: 10.1016/j.febslet.2006.11.064 Stimulation of nonselective amino acid export by glutamine dumper proteins.2010 · DOI: 10.1104/pp.109.151746 The ubiquitin E3 ligase LOSS OF GDU2 is required for GLUTAMINE DUMPER1-induced amino acid secretion in Arabidopsis.2012 · DOI: 10.1104/pp.111.191965
`At5g57685`	Probable subunit of an amino acid transporter involved in the regulation of the amino acid metabolism.	Up-regulation of LSB1/GDU3 affects geminivirus infection by activating the salicylic acid pathway.2010 · DOI: 10.1111/j.1365-313x.2009.04120.x
`At2g24762`	Probable subunit of an amino acid transporter involved in the regulation of the amino acid metabolism.	No verified direct reference in this release
`At3g30725`	Probable subunit of an amino acid transporter involved in the regulation of the amino acid metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006449 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006521 regulation of amino acid metabolic process Biological Process

GO:0006865 amino acid transport Biological Process

GO:0009615 response to virus Biological Process

GO:0010585 glutamine secretion Biological Process

GO:0032940 secretion by cell Biological Process

GO:0044788 host-mediated perturbation of viral process Biological Process

GO:0080143 regulation of amino acid export Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G24762

ath:AT4G25760

ath:AT4G31730

ath:AT5G24920

ath:AT5G57685

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.759

Rank 1 · TkA03G037540 · TK1151

Endoplasmic reticulum0.137

Rank 2 · TkA03G037540 · TK1151

Cytoplasm0.098

Rank 3 · TkA03G037540 · TK1151

Nucleus0.098

Rank 4 · TkA03G037540 · TK1151

Lysosome / Vacuole0.054

Rank 5 · TkA03G037540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27655GDU_TM27-73 aa

PF27946C1orf16231-74 aa

PF17884DUF559144-64 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G037540	`PF27655`	GDU_TM	27	73	2.6e-20	72.7
TkA03G037540	`PF27946`	C1orf162	31	74	0.0098	16.4
TkA03G037540	`PF17884`	DUF5591	44	64	0.0067	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E965`	Arabidopsis thaliana	sp\|Q3E965\|GDU5_ARATH Protein GLUTAMINE DUMPER 5	45.300%	Swiss-Prot	Medium
`O81775`	Arabidopsis thaliana	sp\|O81775\|GDU1_ARATH Protein GLUTAMINE DUMPER 1	47.600%	Swiss-Prot	Medium
`Q9FHH5`	Arabidopsis thaliana	sp\|Q9FHH5\|GDU3_ARATH Protein GLUTAMINE DUMPER 3	42.500%	Swiss-Prot	Medium
`Q8S8A0`	Arabidopsis thaliana	sp\|Q8S8A0\|GDU4_ARATH Protein GLUTAMINE DUMPER 4	46.400%	Swiss-Prot	Medium
`Q3EAV6`	Arabidopsis thaliana	sp\|Q3EAV6\|GDU6_ARATH Protein GLUTAMINE DUMPER 6	40.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card