TkA03G035500 | RubberDandelionOmics

Gene overview

TkA03G035500

Reference: TK1151 Chr: Chr03 Coordinates: 9359981-9364188 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2718 bp · TkA03G035500|TK1151|cDNA

GCCCAAACCTAATTGCTTCCCTCGCCTCCTTCTCCGCTGTATGCTGTTTGATATTTGAGTGTGTCACTTTGTCATCGCAGGAATCACCCATCGCCGCCCATTGAGAGCCGGGGTGAGCTCAAAATCCATCTGCCGATACCTCCATCTGCCCGACGCAACACAGGGAAGTTGAAATCGTTTAGTTTATCAAATAAAGGATGCCGGCGACAGAAATAACGGCAGACGCATTGTCGGCGTCTGGCCGAACTTCAGAAAAGCTC...

CDS

Download CDS FASTA

2322 bp · TkA03G035500|TK1151|CDS

ATGCCGGCGACAGAAATAACGGCAGACGCATTGTCGGCGTCTGGCCGAACTTCAGAAAAGCTCAGCCTGCCTACGCTTCAATCTAAAATGAAATGCGACCCTGAAGGCTATGAGACCGAGCTAACCCTAATTTACAACCAATTTAAGTCGGCTGTCGAACTTTTCCAACAACAAGCGGCACTAAATTTCACCTCTGTCGTCAGTGGCGGTGTTGGAAGCGACCCTACCGTTGCCAAAGACCTCGGCGACCGCGCCATGTT...

Protein

Download Protein FASTA

773 aa · TkA03G035500|TK1151|PROTEIN

MPATEITADALSASGRTSEKLSLPTLQSKMKCDPEGYETELTLIYNQFKSAVELFQQQAALNFTSVVSGGVGSDPTVAKDLGDRAMFLAHVTPFYPNQLLNYPKELVEFLKSSARVLPSSLRVTVTQALILLLNRKIVAIKETLALFMELQVLSDKPLKELAFSHVIHSIKRMNQKHKNETENRALQSILFSMLQEEDEKKAMRSLVTICDLHRRKVWFDDRTANAICRACFHSSSRIMIAALSFLLDYEKIEQENDSDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G035500`
TK1151 ID	TkA03G035500
OH-1004 ID	LXL04_006420
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.400
Protein coverage (%)	TK1151 99.871 / OH-1004 94.784 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G035500`
Location	Chr03:9359981-9364188 (+)
Description	Similar to SDAD1: Protein SDA1 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006420` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000055 ribosomal large subunit export from nucleus Biological Process GO:0015031 protein transport Biological Process GO:0042273 ribosomal large subunit biogenesis Biological Process GO:1990830 cellular response to leukemia inhibitory factor Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component
KEGG gene cross-reference	dre:286746 hsa:55153 mmu:231452 rno:289504 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · TkA03G035500 · TK1151

Cytoplasm0.105

Rank 2 · TkA03G035500 · TK1151

Cell membrane0.014

Rank 3 · TkA03G035500 · TK1151

Mitochondrion0.013

Rank 4 · TkA03G035500 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA03G035500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08158SDA1_HEAT87-462 aa

PF17298DUF5349245-323 aa

PF05285SDA1_dom254-311 aa

PF21638SDA1_C293-315 aa

PF05285SDA1_dom523-707 aa

PF08158SDA1_HEAT559-593 aa

PF08158SDA1_HEAT710-756 aa

PF21638SDA1_C726-771 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G035500	`PF08158`	SDA1_HEAT	87	462	5.7e-130	434.2
TkA03G035500	`PF17298`	DUF5349	245	323	0.18	12.0
TkA03G035500	`PF05285`	SDA1_dom	254	311	2.2e-06	29.0
TkA03G035500	`PF21638`	SDA1_C	293	315	6.1e-05	24.0
TkA03G035500	`PF05285`	SDA1_dom	523	707	2.2e-06	29.0
TkA03G035500	`PF08158`	SDA1_HEAT	559	593	5.7e-130	434.2
TkA03G035500	`PF08158`	SDA1_HEAT	710	756	5.7e-130	434.2
TkA03G035500	`PF21638`	SDA1_C	726	771	6.1e-05	24.0
TkA03G035500	`PF05285`	SDA1_dom	736	744	2.2e-06	29.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card