TkA03G034210 | RubberDandelionOmics

Gene overview

TkA03G034210

Reference: TK1151 Chr: Chr03 Coordinates: 9034229-9035188 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

960 bp · TkA03G034210|TK1151|cDNA

ATGATCGGCACGACGATGACCCAACAAACACTAATTTATTACCTATCGGAACACCCTTCAATAGTCAAATTCAGGTGGAGCCACACAGAATCATGGGGCTCCACCTGGTCGTTTCTCTTCACCTCCATATCCGCCTACCTCCTCCTCGCACTCCTCCTCCACTTCCTCCTGTACTACCGCCGACGGCCTGTTCCGCTCGGCCCAATCCCTGCCCTACACTCGCTTTCGATGGCGCTCATATCGGTCACAATCTTCACCGG...

CDS

Download CDS FASTA

960 bp · TkA03G034210|TK1151|CDS

ATGATCGGCACGACGATGACCCAACAAACACTAATTTATTACCTATCGGAACACCCTTCAATAGTCAAATTCAGGTGGAGCCACACAGAATCATGGGGCTCCACCTGGTCGTTTCTCTTCACCTCCATATCCGCCTACCTCCTCCTCGCACTCCTCCTCCACTTCCTCCTGTACTACCGCCGACGGCCTGTTCCGCTCGGCCCAATCCCTGCCCTACACTCGCTTTCGATGGCGCTCATATCGGTCACAATCTTCACCGG...

Protein

Download Protein FASTA

319 aa · TkA03G034210|TK1151|PROTEIN

MIGTTMTQQTLIYYLSEHPSIVKFRWSHTESWGSTWSFLFTSISAYLLLALLLHFLLYYRRRPVPLGPIPALHSLSMALISVTIFTGILFSAAAEIRDTRWFWRRTKTTPFEWFLCFPMGTRPSGRVFFWSYIFYLTRFLHTFRTFFAILRRRNLSFFRLFNHSILILMSFLWLEFSQSFQIIGILLTTAIYSVVYGYRFWTAIGLRSACFPFVINCQMVLLGCNLICHIGVLLLHLQKGGCNGIGAWGINSVLNAAILL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G034210`
TK1151 ID	TkA03G034210
OH-1004 ID	LXL04_024242
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	84.800
Protein coverage (%)	TK1151 51.411 / OH-1004 87.701 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G034210

Location Chr03:9034229-9035188 (+)

Description Similar to HOS3: Elongation of fatty acids protein 3-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36830`	Probable very long-chain fatty acid (VLCFA) elongase that controls VLCFA composition and functions to inhibit abscisic acid (ABA)-mediated stress responses, including regulation of stomatal aperture, maintenance of primary root growth and inhibition of germination.	HOS3, an ELO-like gene, inhibits effects of ABA and implicates a S-1-P/ceramide control system for abiotic stress responses in Arabidopsis thaliana.2009 · DOI: 10.1093/mp/ssn085

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024242 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019367 fatty acid elongation, saturated fatty acid Biological Process

GO:0030148 sphingolipid biosynthetic process Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0034625 fatty acid elongation, monounsaturated fatty acid Biological Process

GO:0034626 fatty acid elongation, polyunsaturated fatty acid Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0009922 fatty acid elongase activity Molecular Function

KEGG gene cross-reference

ath:AT4G36830

ddi:DDB_G0272012

ddi:DDB_G0274669

ddi:DDB_G0281821

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.652

Rank 1 · TkA03G034210 · TK1151

Nucleus0.132

Rank 2 · TkA03G034210 · TK1151

Golgi apparatus0.092

Rank 3 · TkA03G034210 · TK1151

Cytoplasm0.090

Rank 4 · TkA03G034210 · TK1151

Cell membrane0.081

Rank 5 · TkA03G034210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01151ELO33-277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G034210	`PF01151`	ELO	33	277	3.6e-41	142.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYY4`	Arabidopsis thaliana	sp\|Q9SYY4\|ELO3L_ARATH Fatty acid elongase 3-like	67.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card