TkA03G025710 | RubberDandelionOmics

Gene overview

TkA03G025710

Reference: TK1151 Chr: Chr03 Coordinates: 6647617-6649597 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1776 bp · TkA03G025710|TK1151|cDNA

ATTTATTAGGGTTTTTATTGCCGAGTCCCAAAAAAACAAACCCACATTCAATGCAGAACGCGGTTTTAGGGAGACGATGTACATGATAATGATAATATCGCGACACATACACACACATACACACACAGTGGGGTGGGCTGACTTTAGCTTTAAGCTGCGTACTGCCATAGCTGTGCCAGCATGCATGAGCTTTGAGTAAATGCTCTCTTTGGGTCTTCGCTGTCACCCCACCCCACCCCACTATCCCTTTTGACTCTTTA...

CDS

Download CDS FASTA

972 bp · TkA03G025710|TK1151|CDS

ATGGGGCGGCCTCCATGTTGTGATAAACTTGGTGTCAAGAAAGGTCCATGGACTCCTGAAGAAGATATCATGCTTGTTTCTTATGTTCAACAACATGGTCCTGGGAATTGGCGCCAAGTCCCTACTAACACTGGACTTAGAAGATGCAGCAAGAGTTGTAGGTTGAGATGGACGAATTATTTAAGGCCGGGAATAAGAAGGGGGGATTTCACCGATGATGAAGAGAAAATGATAATTCAACTTCAAGCTCTTTTGGGTAA...

Protein

Download Protein FASTA

323 aa · TkA03G025710|TK1151|PROTEIN

MGRPPCCDKLGVKKGPWTPEEDIMLVSYVQQHGPGNWRQVPTNTGLRRCSKSCRLRWTNYLRPGIRRGDFTDDEEKMIIQLQALLGNKWAAIASYLPERTDNDIKNYWNTHLKKKLKKLEMGSDNINVNNKDRFSSSTSSSSSSHCVSRGQWEKRLQTDIHMAKQALNDALSIDQKPVFVPQTTKSSSQTPAYPSSTDNIAKLLKGFMKNSAVYTKTCSDSSVHESSGEVNASESKIDLSEAFESLFGFDQSFGSSPNNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G025710`
TK1151 ID	TkA03G025710
OH-1004 ID	LXL04_006284
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G025710

Location Chr03:6647617-6649597 (+)

Description Similar to MYB30: Transcription factor MYB30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28910`	Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3'.	A novel myb oncogene homologue in Arabidopsis thaliana related to hypersensitive cell death.1999 · DOI: 10.1046/j.1365-313x.1999.00578.x A R2R3-MYB gene, AtMYB30, acts as a positive regulator of the hypersensitive cell death program in plants in response to pathogen attack.2002 · DOI: 10.1073/pnas.152047199 An essential role for salicylic acid in AtMYB30-mediated control of the hypersensitive cell death program in Arabidopsis.2006 · DOI: 10.1016/j.febslet.2006.05.027 A MYB transcription factor regulates very-long-chain fatty acid biosynthesis for activation of the hypersensitive cell death response in Arabidopsis.2008 · DOI: 10.1105/tpc.107.054858 Arabidopsis MYB30 is a direct target of BES1 and cooperates with BES1 to regulate brassinosteroid-induced gene expression.2009 · DOI: 10.1111/j.1365-313x.2008.03778.x AtsPLA2-alpha nuclear relocalization by the Arabidopsis transcription factor AtMYB30 leads to repression of the plant defense response.2010 · DOI: 10.1073/pnas.1009056107 Sumoylation of transcription factor MYB30 by the small ubiquitin-like modifier E3 ligase SIZ1 mediates abscisic acid response in Arabidopsis thaliana.2012 · DOI: 10.1073/pnas.1202630109 Elevated levels of MYB30 in the phloem accelerate flowering in Arabidopsis through the regulation of FLOWERING LOCUS T.2014 · DOI: 10.1371/journal.pone.0089799
`At3g47600`	Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress.	Cuticular wax biosynthesis is up-regulated by the MYB94 transcription factor in Arabidopsis.2015 · DOI: 10.1093/pcp/pcu142 MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis.2016 · DOI: 10.1093/pcp/pcw147
`At5g62470`	Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress.	The MYB96 transcription factor mediates abscisic acid signaling during drought stress response in Arabidopsis.2009 · DOI: 10.1104/pp.109.144220 MYB96-mediated abscisic acid signals induce pathogen resistance response by promoting salicylic acid biosynthesis in Arabidopsis.2010 · DOI: 10.1111/j.1469-8137.2010.03183.x The MYB96 transcription factor regulates cuticular wax biosynthesis under drought conditions in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083485 Lipid transfer protein 3 as a target of MYB96 mediates freezing and drought stress in Arabidopsis.2013 · DOI: 10.1093/jxb/ert040 The Arabidopsis MYB96 transcription factor plays a role in seed dormancy.2015 · DOI: 10.1007/s11103-015-0283-4 The Arabidopsis MYB96 Transcription Factor Is a Positive Regulator of ABSCISIC ACID-INSENSITIVE4 in the Control of Seed Germination.2015 · DOI: 10.1104/pp.15.00162 The MYB96-HHP module integrates cold and abscisic acid signaling to activate the CBF-COR pathway in Arabidopsis.2015 · DOI: 10.1111/tpj.12866 MYB96 shapes the circadian gating of ABA signaling in Arabidopsis.2016 · DOI: 10.1038/srep17754 MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis.2016 · DOI: 10.1093/pcp/pcw147 MYB96 recruits the HDA15 protein to suppress negative regulators of ABA signaling in Arabidopsis.2019 · DOI: 10.1038/s41467-019-09417-1

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006284 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

KEGG gene cross-reference

ath:AT3G28910

ath:AT3G47600

ath:AT5G62470

vvi:100233072

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.886

Rank 1 · TkA03G025710 · TK1151

Cytoplasm0.240

Rank 2 · TkA03G025710 · TK1151

Mitochondrion0.026

Rank 3 · TkA03G025710 · TK1151

Cell membrane0.021

Rank 4 · TkA03G025710 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA03G025710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding14-61 aa

PF13921Myb_DNA-bind_617-77 aa

PF23588HTH_CHD1_Hrp317-46 aa

PF00249Myb_DNA-binding67-112 aa

PF13921Myb_DNA-bind_670-118 aa

PF15963Myb_DNA-bind_773-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G025710	`PF00249`	Myb_DNA-binding	14	61	5e-35	120.1
TkA03G025710	`PF13921`	Myb_DNA-bind_6	17	77	2.4e-21	76.4
TkA03G025710	`PF23588`	HTH_CHD1_Hrp3	17	46	0.0045	17.7
TkA03G025710	`PF00249`	Myb_DNA-binding	67	112	5e-35	120.1
TkA03G025710	`PF13921`	Myb_DNA-bind_6	70	118	2.4e-21	76.4
TkA03G025710	`PF15963`	Myb_DNA-bind_7	73	135	0.028	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCU7`	Arabidopsis thaliana	sp\|Q9SCU7\|MYB30_ARATH Transcription factor MYB30	52.100%	Swiss-Prot	High
`Q9SN78`	Arabidopsis thaliana	sp\|Q9SN78\|MYB94_ARATH Transcription factor MYB94	63.300%	Swiss-Prot	Medium
`Q24JK1`	Arabidopsis thaliana	sp\|Q24JK1\|MYB96_ARATH Transcription factor MYB96	49.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card