TkA03G024500 | RubberDandelionOmics

Gene overview

TkA03G024500

Reference: TK1151 Chr: Chr03 Coordinates: 6300301-6302227 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1112 bp · TkA03G024500|TK1151|cDNA

GGAAAACCTTCCTCTACATTGTAAGCGTCCAACATGTTTTTTGCTGTTTGTATAGTGTTCTGTTTTTCCACCCACCATAAGAACAGCCTTTCACACCAATACACACACACATACACACACTTTGCCAAAAATCCTATCCACTATTTCTACAATCTCTTAAAAAACAACAAAATTCCCTATTTAATTTCCATGTCCTTCCTTCCACCTGAACCCATGTTCTTCGGCTATGAAGATCACTTCCAAGGTCCCCATGAGCCACT...

CDS

Download CDS FASTA

531 bp · TkA03G024500|TK1151|CDS

ATGTTTTTTGCTGTTTGTATAGTGTTCTGTTTTTCCACCCACCATAAGAACAGCCTTTCACACCAATACACACACACATACACACACTTTGCCAAAAATCCTATCCACTATTTCTACAATCTCTTAAAAAACAACAAAATTCCCTATTTAATTTCCATGTCCTTCCTTCCACCTGAACCCATGTTCTTCGGCTATGAAGATCACTTCCAAGGTCCCCATGAGCCACTGATGAGAAGATCGATGTCATATTCCGGGAGAGA...

Protein

Download Protein FASTA

176 aa · TkA03G024500|TK1151|PROTEIN

MFFAVCIVFCFSTHHKNSLSHQYTHTYTHFAKNPIHYFYNLLKNNKIPYLISMSFLPPEPMFFGYEDHFQGPHEPLMRRSMSYSGRELCDQEVMTNGCDGETSEDEGSQLGEKKRRLNLEQVKALEKSFEIGNKLEPDRKRQLARALGCNHDKWLYGFKTGGLDGRLNSWKEITMC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G024500`
TK1151 ID	TkA03G024500
OH-1004 ID	LXL04_006273
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 54.545 / OH-1004 38.554 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G024500

Location Chr03:6300301-6302227 (+)

Description Similar to HAT7: Homeobox-leucine zipper protein HAT7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69780`	Probable transcription factor that may act in the sucrose-signaling pathway.	No verified direct reference in this release
`At1g26960`	Probable transcription factor.	No verified direct reference in this release
`At3g01220`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XD08`	Probable transcription factor.	No verified direct reference in this release
`Os03g0170600`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006273 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048826 cotyledon morphogenesis Biological Process

GO:0080022 primary root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G69780

ath:AT3G01220

ath:AT5G15150

dosa:Os03g0170600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.906

Rank 1 · TkA03G024500 · TK1151

Cytoplasm0.171

Rank 2 · TkA03G024500 · TK1151

Cell membrane0.030

Rank 3 · TkA03G024500 · TK1151

Endoplasmic reticulum0.026

Rank 4 · TkA03G024500 · TK1151

Mitochondrion0.021

Rank 5 · TkA03G024500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046Homeodomain113-148 aa

PF10003DUF2244123-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G024500	`PF00046`	Homeodomain	113	148	0.0017	18.8
TkA03G024500	`PF10003`	DUF2244	123	148	0.29	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LC03`	Arabidopsis thaliana	sp\|Q8LC03\|ATB13_ARATH Homeobox-leucine zipper protein ATHB-13	52.200%	Swiss-Prot	High
`Q8LFD3`	Arabidopsis thaliana	sp\|Q8LFD3\|ATB23_ARATH Homeobox-leucine zipper protein ATHB-23	53.500%	Swiss-Prot	Low
`Q8LAT0`	Arabidopsis thaliana	sp\|Q8LAT0\|ATB20_ARATH Homeobox-leucine zipper protein ATHB-20	56.100%	Swiss-Prot	Low
`A2XD08`	Oryza sativa subsp. indica	sp\|A2XD08\|HOX21_ORYSI Homeobox-leucine zipper protein HOX21	79.500%	Swiss-Prot	Low
`Q8S7W9`	Oryza sativa subsp. japonica	sp\|Q8S7W9\|HOX21_ORYSJ Homeobox-leucine zipper protein HOX21	79.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card