TkA03G023640 | RubberDandelionOmics

Gene overview

TkA03G023640

Reference: TK1151 Chr: Chr03 Coordinates: 6089808-6095261 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · TkA03G023640|TK1151|cDNA

ATGGGGAAATCTCCTGGAATGTGGGTGAAATCTGTACATTTCGGGAAAAAGTCATCAAAATCCAATCTCTCAAAAGATGATGCAACTTCACACAAAAACACCTTGTTTACCATCACCTCACAATCAAACAGCTTTAATGCTGATTCTACTAGCATATCAAGTCCAGCATGCCACGTCATCACACAGTTACAGAAGAGCTTCAGTTCCAATTCATTGCATGATAATGATAATAATGCTTCAAATGATGATGAGTTGGACTT...

CDS

Download CDS FASTA

504 bp · TkA03G023640|TK1151|CDS

ATGGGGAAATCTCCTGGAATGTGGGTGAAATCTGTACATTTCGGGAAAAAGTCATCAAAATCCAATCTCTCAAAAGATGATGCAACTTCACACAAAAACACCTTGTTTACCATCACCTCACAATCAAACAGCTTTAATGCTGATTCTACTAGCATATCAAGTCCAGCATGCCACGTCATCACACAGTTACAGAAGAGCTTCAGTTCCAATTCATTGCATGATAATGATAATAATGCTTCAAATGATGATGAGTTGGACTT...

Protein

Download Protein FASTA

167 aa · TkA03G023640|TK1151|PROTEIN

MGKSPGMWVKSVHFGKKSSKSNLSKDDATSHKNTLFTITSQSNSFNADSTSISSPACHVITQLQKSFSSNSLHDNDNNASNDDELDLEQAATMLQAAFRGYLDRRVFWVLQGVIRIQAVIRGQLVRRRTLYSMCAIVELQAVVRGQIVRLSERFPQMVQKKLYKNMW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G023640`
TK1151 ID	TkA03G023640
OH-1004 ID	LXL04_006251
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	56.100
Protein coverage (%)	TK1151 96.407 / OH-1004 37.255 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G023640

Location Chr03:6089808-6095261 (+)

Description Similar to IQD31: Protein IQ-DOMAIN 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14380`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g18840`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g74690`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At2g02790`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g59690`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006251 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005875 microtubule associated complex Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G14380

ath:AT1G18840

ath:AT1G74690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.387

Rank 1 · TkA03G023640 · TK1151

Nucleus0.346

Rank 2 · TkA03G023640 · TK1151

Cell membrane0.282

Rank 3 · TkA03G023640 · TK1151

Endoplasmic reticulum0.078

Rank 4 · TkA03G023640 · TK1151

Plastid0.063

Rank 5 · TkA03G023640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27174YeeD76-103 aa

PF00612IQ89-107 aa

PF00612IQ113-128 aa

PF00612IQ134-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G023640	`PF27174`	YeeD	76	103	0.12	13.5
TkA03G023640	`PF00612`	IQ	89	107	3.2e-13	48.9
TkA03G023640	`PF00612`	IQ	113	128	3.2e-13	48.9
TkA03G023640	`PF00612`	IQ	134	150	3.2e-13	48.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GZ87`	Arabidopsis thaliana	sp\|Q8GZ87\|IQD28_ARATH Protein IQ-DOMAIN 28	38.200%	Swiss-Prot	Medium
`Q501D2`	Arabidopsis thaliana	sp\|Q501D2\|IQD30_ARATH Protein IQ-DOMAIN 30	33.300%	Swiss-Prot	Medium
`Q8L4D8`	Arabidopsis thaliana	sp\|Q8L4D8\|IQD31_ARATH Protein IQ-DOMAIN 31	38.300%	Swiss-Prot	Medium
`A0A1P8B0B7`	Arabidopsis thaliana	sp\|A0A1P8B0B7\|IQD29_ARATH Protein IQ-DOMAIN 29	35.300%	Swiss-Prot	Medium
`Q9M199`	Arabidopsis thaliana	sp\|Q9M199\|IQD13_ARATH Protein IQ-DOMAIN 13	51.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card