TkA03G023290 | RubberDandelionOmics

Gene overview

TkA03G023290

Reference: TK1151 Chr: Chr03 Coordinates: 6027915-6028931 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1017 bp · TkA03G023290|TK1151|cDNA

ATGACTGAAATCTTCACGAGACTACCATCCAAAACACTCGTGCAATGCAGATCAGTCTCCAAATCATGGTACTCTTATATCGGTAGCCCTGATTTCATCCGCATGTACACTTGTCGATCCCAACAAAAACTCGTAATAAGACACCGAACTTATAACGAAAATCAAGAAGGTGAATATGAAGGTTTCTACACATTACATTCACGTGACGAATTTCCATTGTGTCCCACACGTGGATATGTTGGTATACCACAATTACAGTT...

CDS

Download CDS FASTA

1017 bp · TkA03G023290|TK1151|CDS

ATGACTGAAATCTTCACGAGACTACCATCCAAAACACTCGTGCAATGCAGATCAGTCTCCAAATCATGGTACTCTTATATCGGTAGCCCTGATTTCATCCGCATGTACACTTGTCGATCCCAACAAAAACTCGTAATAAGACACCGAACTTATAACGAAAATCAAGAAGGTGAATATGAAGGTTTCTACACATTACATTCACGTGACGAATTTCCATTGTGTCCCACACGTGGATATGTTGGTATACCACAATTACAGTT...

Protein

Download Protein FASTA

338 aa · TkA03G023290|TK1151|PROTEIN

MTEIFTRLPSKTLVQCRSVSKSWYSYIGSPDFIRMYTCRSQQKLVIRHRTYNENQEGEYEGFYTLHSRDEFPLCPTRGYVGIPQLQFPFTYFVIVGSCDGIVCLYDYGDNSIILWNPSIRRTVILPDCPRRCYSEVEVAFGYDPIADDYKVVSLPIVNVNRDGGSYVYAMKTDACFLIDSPMPDFRKVKTKACFVSGALHWLAQRYKKSNWYILTFDLSTHVFSSVVSPHITRTVVPISLRGCLAIIINESSIWVRRDDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G023290`
TK1151 ID	TkA03G023290
OH-1004 ID	LXL04_006258
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 74.556 / OH-1004 80.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G023290

Location Chr03:6027915-6028931 (-)

Description Similar to At3g06240: F-box/kelch-repeat protein At3g06240

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47790`	Putative F-box protein At1g47790.	No verified direct reference in this release
`At3g16210`	Putative F-box protein At3g16210.	No verified direct reference in this release
`At4g21240`	Putative F-box protein At4g21240.	No verified direct reference in this release
`At5g18160`	F-box protein At5g18160.	No verified direct reference in this release
`At1g50870`	Putative F-box protein At1g50870.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006258 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G32420

ath:AT1G47790

ath:AT3G16210

ath:AT3G23880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.635

Rank 1 · TkA03G023290 · TK1151

Nucleus0.395

Rank 2 · TkA03G023290 · TK1151

Cell membrane0.114

Rank 3 · TkA03G023290 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA03G023290 · TK1151

Lysosome / Vacuole0.045

Rank 5 · TkA03G023290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box2-33 aa

PF12937F-box-like3-30 aa

PF08268FBA_390-262 aa

PF07734FBA_195-233 aa

PF12937F-box-like247-256 aa

PF08268FBA_3295-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G023290	`PF00646`	F-box	2	33	6.1e-07	29.8
TkA03G023290	`PF12937`	F-box-like	3	30	6.3e-05	23.4
TkA03G023290	`PF08268`	FBA_3	90	262	4.6e-19	69.3
TkA03G023290	`PF07734`	FBA_1	95	233	4.2e-16	59.6
TkA03G023290	`PF12937`	F-box-like	247	256	6.3e-05	23.4
TkA03G023290	`PF08268`	FBA_3	295	311	4.6e-19	69.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZF8`	Arabidopsis thaliana	sp\|Q9FZF8\|FB44_ARATH Putative F-box protein At1g47790	28.700%	Swiss-Prot	Low
`Q9LU24`	Arabidopsis thaliana	sp\|Q9LU24\|FB145_ARATH Putative F-box protein At3g16210	28.600%	Swiss-Prot	Low
`O49565`	Arabidopsis thaliana	sp\|O49565\|FB239_ARATH Putative F-box protein At4g21240	27.300%	Swiss-Prot	Low
`Q9FK54`	Arabidopsis thaliana	sp\|Q9FK54\|FB260_ARATH F-box protein At5g18160	23.500%	Swiss-Prot	Low
`Q9C6J3`	Arabidopsis thaliana	sp\|Q9C6J3\|FB52_ARATH Putative F-box protein At1g50870	23.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card