TkA03G020940 | RubberDandelionOmics

Gene overview

TkA03G020940

Reference: TK1151 Chr: Chr03 Coordinates: 5403539-5406582 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1162 bp · TkA03G020940|TK1151|cDNA

TTTCTCGGTATTTTCGTGTAAATTTCCAAACTTTTGGGATTTACTTCTTTTAGTCAAAACAAGGGGTAGTTTCGTCATTTCCAATAGCTCGAAATAAACGCGCAAAAAATATTCCAACGGCGCGAGAAAATCTCGGCCGGCGGTTAACACCCGTAAACTATATTCTCTTCCGTCAATCCCTCCATTTCAAACTCATCTTCCTCTTCGATCTTCAAACCCTAACGCGCCTACTTCACACATTTGAATCATGGGTCAATCAC...

CDS

Download CDS FASTA

864 bp · TkA03G020940|TK1151|CDS

ATGGGTCAATCACTTGGATGCATTCAAGTTGACCAGTCAACAGTAGCCGTGAAAGAACATTTTGGGAAATTTGATAAAGTACTTGAACCCGGTTGTCACTGTGTGCCTTGGTGTTTCGGGTACGGGCTGGCTGGTAAACTTTCATTACGTGTCAATCAACTTGATGTTCGTTGTGAGACAAAAACAAAGGACAATGTGTTTGTTACTGTGGTTGCATCTGTACAGTATCGTGCCTTGTCTGATAAGGCTGCTGATGCTTT...

Protein

Download Protein FASTA

287 aa · TkA03G020940|TK1151|PROTEIN

MGQSLGCIQVDQSTVAVKEHFGKFDKVLEPGCHCVPWCFGYGLAGKLSLRVNQLDVRCETKTKDNVFVTVVASVQYRALSDKAADAFYKLSNTKQQVQAYVFDVIRANVPKLPLDDVFLQKNDIARGVEEELEKAMSGYGFEIVQTLIVDIEPDQHVKRSMNEINAAARMRLAATEKAEAEKILQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLAFSENVPGTSSKDVMDMVLLTQYFDTMKEIGASSKSNAVFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G020940`
TK1151 ID	TkA03G020940
OH-1004 ID	LXL04_006245
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G020940

Location Chr03:5403539-5406582 (+)

Description Similar to HIR1: Hypersensitive-induced response protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69840`	Hypersensitive-induced response protein 2.	No verified direct reference in this release
`At5g62740`	Positive regulator of hypersensitive response (HR)-like cell death.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0361200`	Positive regulator of hypersensitive response (HR)-like cell death.	No verified direct reference in this release
`Os08g0398400`	Positive regulator of hypersensitive response (HR)-like cell death.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006245 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0043424 protein histidine kinase binding Molecular Function

KEGG gene cross-reference

ath:AT5G62740

cann:107862499

dosa:Os05g0591900

dosa:Os08g0398400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.754

Rank 1 · TkA03G020940 · TK1151

Cytoplasm0.259

Rank 2 · TkA03G020940 · TK1151

Nucleus0.096

Rank 3 · TkA03G020940 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA03G020940 · TK1151

Mitochondrion0.065

Rank 5 · TkA03G020940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01145Band_79-182 aa

PF02169LPP2050-83 aa

PF13421Band_7_194-165 aa

PF09744RH1123-149 aa

PF02169LPP20195-231 aa

PF02169LPP20266-276 aa

PF09744RH1267-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G020940	`PF01145`	Band_7	9	182	6e-28	98.7
TkA03G020940	`PF02169`	LPP20	50	83	0.32	12.2
TkA03G020940	`PF13421`	Band_7_1	94	165	0.17	12.1
TkA03G020940	`PF09744`	RH1	123	149	0.15	12.6
TkA03G020940	`PF02169`	LPP20	195	231	0.32	12.2
TkA03G020940	`PF02169`	LPP20	266	276	0.32	12.2
TkA03G020940	`PF09744`	RH1	267	274	0.15	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAR7`	Arabidopsis thaliana	sp\|Q9CAR7\|HIR2_ARATH Hypersensitive-induced response protein 2	83.700%	Swiss-Prot	High
`Q9FM19`	Arabidopsis thaliana	sp\|Q9FM19\|HIR1_ARATH Hypersensitive-induced response protein 1	82.500%	Swiss-Prot	High
`Q6K550`	Oryza sativa subsp. japonica	sp\|Q6K550\|HIRL2_ORYSJ Hypersensitive-induced response protein-like protein 2	81.600%	Swiss-Prot	High
`Q6ZIV7`	Oryza sativa subsp. japonica	sp\|Q6ZIV7\|HIR1_ORYSJ Hypersensitive-induced response protein 1	82.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card