TkA03G014480 | RubberDandelionOmics

Gene overview

TkA03G014480

Reference: TK1151 Chr: Chr03 Coordinates: 3748458-3753093 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2719 bp · TkA03G014480|TK1151|cDNA

CTTCCTTTTAGATTTAGTGATTTACATATTGTGTCATAGCACATGATTAAGACCAAGATAGAGTTGACCCAAACCTCATGGCATCTTCCTCACTCGAAGAAATTAAACAAATCCTTCCACATTTAAACTTGCAGGCCTCTAATCCGCCTCCTTGAACCTTCCATTTGCACGCTACAAAGTACAATCTCTCTTTTTTTTTTTTCTCTATTTTGACTAGTCAACGTCTGCAACCCTTCAATCTTTTTGTACATTCTTCTTTC...

CDS

Download CDS FASTA

1986 bp · TkA03G014480|TK1151|CDS

ATGGCACCGAGTTCTGTGGTGGTGACCATAGACAAACCGAGTAACATCTCGTTGGTTGAAGTCGACGATAATGATTCGGAAACTTCCGTGTTTCTCGAAAAGCAGAAAACAGCGAGCACGAAGCAGTTTTCATGGCTGCTTTTACTCAAAGCTCAACGAATCATCTCTTTCTTTCCATGGTTAGCAATGGGTTTTTCCAGAACTTTCACCTCTGTTAAAAAGCGCATTGCGTTATCAGATTCAAGTAAAGACGAAGTCAA...

Protein

Download Protein FASTA

661 aa · TkA03G014480|TK1151|PROTEIN

MAPSSVVVTIDKPSNISLVEVDDNDSETSVFLEKQKTASTKQFSWLLLLKAQRIISFFPWLAMGFSRTFTSVKKRIALSDSSKDEVKYKEKIMYKFIRAFLAISIVALVVEIIAYYQNWDLKLIPLEAMGLVHLSYMGWISFRAEYLAPSITMLSQFCVLLFMIQSLDRFILGIGCFWIKFKKIKPMIDDQSYDIEDPSSFPMVLVQIPMCNEREVYQQSIASACELDWPKDRILIQVLDDSSDEVLQILIRNEVNLWKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G014480`
TK1151 ID	TkA03G014480
OH-1004 ID	LXL04_006169
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G014480

Location Chr03:3748458-3753093 (+)

Description Similar to CSLC4: Xyloglucan glycosyltransferase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28180`	Beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	A gene from the cellulose synthase-like C family encodes a beta-1,4 glucan synthase.2007 · DOI: 10.1073/pnas.0703133104 Protein-protein interactions among xyloglucan-synthesizing enzymes and formation of Golgi-localized multiprotein complexes.2015 · DOI: 10.1093/pcp/pcu161
`At2g24630`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release
`At4g31590`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0428000`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release
`UniProt: Q7PC70`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006169 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0048868 pollen tube development Biological Process

GO:0071555 cell wall organization Biological Process

GO:0099402 plant organ development Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G24630

ath:AT3G28180

ath:AT4G31590

dosa:Os09g0428000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.434

Rank 1 · TkA03G014480 · TK1151

Golgi apparatus0.255

Rank 2 · TkA03G014480 · TK1151

Cell membrane0.130

Rank 3 · TkA03G014480 · TK1151

Nucleus0.110

Rank 4 · TkA03G014480 · TK1151

Cytoplasm0.107

Rank 5 · TkA03G014480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13632Glyco_trans_2_3129-129 aa

PF03142Chitin_synth_2182-241 aa

PF13641Glyco_tranf_2_3202-435 aa

PF00535Glycos_transf_2207-362 aa

PF03142Chitin_synth_2289-385 aa

PF13632Glyco_trans_2_3296-490 aa

PF03142Chitin_synth_2404-517 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G014480	`PF13632`	Glyco_trans_2_3	129	129	4.1e-19	69.9
TkA03G014480	`PF03142`	Chitin_synth_2	182	241	0.089	12.1
TkA03G014480	`PF13641`	Glyco_tranf_2_3	202	435	1.3e-12	48.7
TkA03G014480	`PF00535`	Glycos_transf_2	207	362	1.1e-10	42.5
TkA03G014480	`PF03142`	Chitin_synth_2	289	385	0.089	12.1
TkA03G014480	`PF13632`	Glyco_trans_2_3	296	490	4.1e-19	69.9
TkA03G014480	`PF03142`	Chitin_synth_2	404	517	0.089	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJP4`	Arabidopsis thaliana	sp\|Q9LJP4\|CSLC4_ARATH Xyloglucan glycosyltransferase 4	72.500%	Swiss-Prot	High
`Q9SJA2`	Arabidopsis thaliana	sp\|Q9SJA2\|CSLC8_ARATH Probable xyloglucan glycosyltransferase 8	68.200%	Swiss-Prot	High
`Q9SB75`	Arabidopsis thaliana	sp\|Q9SB75\|CSLC5_ARATH Probable xyloglucan glycosyltransferase 5	67.700%	Swiss-Prot	High
`Q69L19`	Oryza sativa subsp. japonica	sp\|Q69L19\|CSLC2_ORYSJ Probable xyloglucan glycosyltransferase 2	65.700%	Swiss-Prot	High
`Q7PC70`	Oryza sativa subsp. indica	sp\|Q7PC70\|CSLC2_ORYSI Probable xyloglucan glycosyltransferase 2	65.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card