TkA03G012520 | RubberDandelionOmics

Gene overview

TkA03G012520

Reference: TK1151 Chr: Chr03 Coordinates: 3258360-3259310 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

471 bp · TkA03G012520|TK1151|cDNA

ATGGCTCTACAACAAATTAAATGGAAGGGATTGAGGTTGAAGAGCAATCTGCTCCCAATCGTGGTGGTGGTTAAATGGGGAGAAAGTGAGTATCTGATAAAGAAGAAGTATTGTACCAAGGAGAAACTGTGCATTAATGGAAGAAGTGCAGGGGGGTTGCTTATTGGTGTTGTTCTAAACATGAGACCTGATTTGTTCATAGCTGCTGTAGCTGGAGTTTCGTTTGTAGATGTAAAAGCTCAGAGTTATCCGGCTATACT...

CDS

Download CDS FASTA

471 bp · TkA03G012520|TK1151|CDS

ATGGCTCTACAACAAATTAAATGGAAGGGATTGAGGTTGAAGAGCAATCTGCTCCCAATCGTGGTGGTGGTTAAATGGGGAGAAAGTGAGTATCTGATAAAGAAGAAGTATTGTACCAAGGAGAAACTGTGCATTAATGGAAGAAGTGCAGGGGGGTTGCTTATTGGTGTTGTTCTAAACATGAGACCTGATTTGTTCATAGCTGCTGTAGCTGGAGTTTCGTTTGTAGATGTAAAAGCTCAGAGTTATCCGGCTATACT...

Protein

Download Protein FASTA

156 aa · TkA03G012520|TK1151|PROTEIN

MALQQIKWKGLRLKSNLLPIVVVVKWGESEYLIKKKYCTKEKLCINGRSAGGLLIGVVLNMRPDLFIAAVAGVSFVDVKAQSYPAILVTAGLNDPRVLYSEPAKFVAKLREMKRDENVLLFKCEMGAGHFSKSGRFEKLQEDAFTYTFILKILNVV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G012520`
TK1151 ID	TkA03G012520
OH-1004 ID	LXL04_006154
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.100
Protein coverage (%)	TK1151 82.051 / OH-1004 77.835 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G012520`
Location	Chr03:3258360-3259310 (-)
Description	Similar to ptrB: Protease 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006154` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0051603 proteolysis involved in protein catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0004177 aminopeptidase activity Molecular Function GO:0004252 serine-type endopeptidase activity Molecular Function GO:0008239 dipeptidyl-peptidase activity Molecular Function GO:0070012 oligopeptidase activity Molecular Function
KEGG gene cross-reference	ecj:JW1834 eco:b1845 ecoc:C3026_10510 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.341

Rank 1 · TkA03G012520 · TK1151

Cytoplasm0.203

Rank 2 · TkA03G012520 · TK1151

Extracellular0.162

Rank 3 · TkA03G012520 · TK1151

Mitochondrion0.162

Rank 4 · TkA03G012520 · TK1151

Nucleus0.063

Rank 5 · TkA03G012520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00326Peptidase_S930-81 aa

PF00326Peptidase_S982-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G012520	`PF00326`	Peptidase_S9	30	81	6.8e-28	98.4
TkA03G012520	`PF00326`	Peptidase_S9	82	154	6.8e-28	98.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card