TkA03G011340 | RubberDandelionOmics

Gene overview

TkA03G011340

Reference: TK1151 Chr: Chr03 Coordinates: 2935349-2937756 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1473 bp · TkA03G011340|TK1151|cDNA

ATGATTGTCTTCATTCTCTTTGTCATATCACTGTTCTTCTTCTGGCTCATCCGCCACAATGTTTCCAAGCTCCGGCAGCCATTCCCGCCGGGACCAAAACCACTGCCGTACATCGGCAACATAATCACAATGCTTCGAAACAAACCCACATTCCGATGGATTCACAAAATGATGGACGATATGAACACCAAGATTCTATGCCTTCGTCTTGGAAATGTGCATGTGATAGCTGTGAGTGATCCCAAGATTGCTCGTGAGTT...

CDS

Download CDS FASTA

1473 bp · TkA03G011340|TK1151|CDS

ATGATTGTCTTCATTCTCTTTGTCATATCACTGTTCTTCTTCTGGCTCATCCGCCACAATGTTTCCAAGCTCCGGCAGCCATTCCCGCCGGGACCAAAACCACTGCCGTACATCGGCAACATAATCACAATGCTTCGAAACAAACCCACATTCCGATGGATTCACAAAATGATGGACGATATGAACACCAAGATTCTATGCCTTCGTCTTGGAAATGTGCATGTGATAGCTGTGAGTGATCCCAAGATTGCTCGTGAGTT...

Protein

Download Protein FASTA

490 aa · TkA03G011340|TK1151|PROTEIN

MIVFILFVISLFFFWLIRHNVSKLRQPFPPGPKPLPYIGNIITMLRNKPTFRWIHKMMDDMNTKILCLRLGNVHVIAVSDPKIAREFLKDKDGIFASRPDCMSGNLTSGGYQTTVLAPMGDHWKMMRKTLAMKILSVDKHKWLQEKRDVEADNLIRYIYNQCHVDSTVTGGVVNVRTVVQQYSSNVIRKIVFGSRYFGKGSTDGGPGEEEIEHVDSLLTVLSYLYAFSVTDYFPWLRWITDFDGHEMIIRKAIRTARKYQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G011340`
TK1151 ID	TkA03G011340
OH-1004 ID	LXL04_006143
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.100
Protein coverage (%)	TK1151 94.898 / OH-1004 93.666 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G011340

Location Chr03:2935349-2937756 (-)

Description Similar to CYP79A2: Phenylalanine N-monooxygenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05260`	Converts L-phenylalanine into phenylacetaldoxime, the precursor of benzylglucosinolate (glucotropeolin).	Cytochrome P450 CYP79A2 from Arabidopsis thaliana L. Catalyzes the conversion of L-phenylalanine to phenylacetaldoxime in the biosynthesis of benzylglucosinolate.2000 · DOI: 10.1074/jbc.275.19.14659

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006143 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006569 L-tryptophan catabolic process Biological Process

GO:0009625 response to insect Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009684 indoleacetic acid biosynthetic process Biological Process

GO:0010120 camalexin biosynthetic process Biological Process

GO:0019756 cyanogenic glycoside biosynthetic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0052544 defense response by callose deposition in cell wall Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ag:AAF27289

ag:AAT11920

ag:AAV97889

ath:AT5G05260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.910

Rank 1 · TkA03G011340 · TK1151

Cell membrane0.042

Rank 2 · TkA03G011340 · TK1151

Plastid0.036

Rank 3 · TkA03G011340 · TK1151

Cytoplasm0.034

Rank 4 · TkA03G011340 · TK1151

Golgi apparatus0.025

Rank 5 · TkA03G011340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26302YhzF2-27 aa

PF00067p45029-423 aa

PF00067p450424-472 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G011340	`PF26302`	YhzF	2	27	0.36	11.8
TkA03G011340	`PF00067`	p450	29	423	4.8e-70	237.3
TkA03G011340	`PF00067`	p450	424	472	4.8e-70	237.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLC8`	Arabidopsis thaliana	sp\|Q9FLC8\|C79A2_ARATH Phenylalanine N-monooxygenase	51.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card