TkA03G010730 | RubberDandelionOmics

Gene overview

TkA03G010730

Reference: TK1151 Chr: Chr03 Coordinates: 2744514-2746964 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · TkA03G010730|TK1151|cDNA

CTTTGCATATATACATTGACGTTTGATTTAATATGAGTCTCTTATAAACTTAATAAGACCAAAGTTAGGTTAAAAGTCTCAAGTGTCGATTAACGTTAATTAAGAACCTTAATTAGTGCTTGATAGTCATTGTAACCTTCCCCTTATAAAATCCATTGTGGTCTTATTACCTTCCATCAACAAATCTCTCTCTTTCGTTCTAAATGGAGAACAAACTGAATACTGCAGTACAGGATGTGGAAGTTAGAAAAGGACCCTGG...

CDS

Download CDS FASTA

576 bp · TkA03G010730|TK1151|CDS

ATGGAGAACAAACTGAATACTGCAGTACAGGATGTGGAAGTTAGAAAAGGACCCTGGACGATGGAAGAAGACTTGATTCTTATCAACTACATAGCTGATCATGGTGAAGGTGTTTGGAACACTCTTGCCAAGTCCGCAGGTCTTAAAAGAACAGGAAAAAGTTGCCGTCTTCGATGGCTAAACTATCTTCGACCAGATGTAAGAAGGGGAAATATTACACCAGAAGAACAACTTTTGATTATGGAGCTTCATGCAAAGTT...

Protein

Download Protein FASTA

191 aa · TkA03G010730|TK1151|PROTEIN

MENKLNTAVQDVEVRKGPWTMEEDLILINYIADHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKLGNKWSKIAKYLPGRTDNEIKNYWRTRIQKHMKPVENFSGQTSSSQINQTHVTSIQACNVVNPMELSHYPPCDNVMNFPSPLDTETNENTWSMEDLWSMQLLNND

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G010730`
TK1151 ID	TkA03G010730
OH-1004 ID	LXL04_006137
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G010730

Location Chr03:2744514-2746964 (+)

Description Similar to MYB305: Myb-related protein 305

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27810`	Transcription factor involved in photomorphogenesis in the light.	Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.2006 · DOI: 10.1111/j.1365-313x.2006.02756.x MYB108 acts together with MYB24 to regulate jasmonate-mediated stamen maturation in Arabidopsis.2009 · DOI: 10.1104/pp.108.132597 Gibberellin acts through jasmonate to control the expression of MYB21, MYB24, and MYB57 to promote stamen filament growth in Arabidopsis.2009 · DOI: 10.1371/journal.pgen.1000440 The Jasmonate-ZIM domain proteins interact with the R2R3-MYB transcription factors MYB21 and MYB24 to affect Jasmonate-regulated stamen development in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083089

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006137 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0019632 shikimate metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT3G27810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.930

Rank 1 · TkA03G010730 · TK1151

Cytoplasm0.203

Rank 2 · TkA03G010730 · TK1151

Mitochondrion0.023

Rank 3 · TkA03G010730 · TK1151

Cell membrane0.016

Rank 4 · TkA03G010730 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA03G010730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding16-63 aa

PF23588HTH_CHD1_Hrp317-52 aa

PF13921Myb_DNA-bind_619-76 aa

PF08914Myb_Rap120-68 aa

PF00249Myb_DNA-binding69-112 aa

PF13921Myb_DNA-bind_673-119 aa

PF15963Myb_DNA-bind_786-136 aa

PF08914Myb_Rap1110-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G010730	`PF00249`	Myb_DNA-binding	16	63	4.3e-37	126.7
TkA03G010730	`PF23588`	HTH_CHD1_Hrp3	17	52	0.048	14.4
TkA03G010730	`PF13921`	Myb_DNA-bind_6	19	76	1.8e-23	83.2
TkA03G010730	`PF08914`	Myb_Rap1	20	68	0.0093	17.1
TkA03G010730	`PF00249`	Myb_DNA-binding	69	112	4.3e-37	126.7
TkA03G010730	`PF13921`	Myb_DNA-bind_6	73	119	1.8e-23	83.2
TkA03G010730	`PF15963`	Myb_DNA-bind_7	86	136	0.016	15.8
TkA03G010730	`PF08914`	Myb_Rap1	110	120	0.0093	17.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK95`	Arabidopsis thaliana	sp\|Q9LK95\|MYB21_ARATH Transcription factor MYB21	57.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card