TkA03G010690 | RubberDandelionOmics

Gene overview

TkA03G010690

Reference: TK1151 Chr: Chr03 Coordinates: 2712811-2719170 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1738 bp · TkA03G010690|TK1151|cDNA

AGAAACACAGAGTCCCACATGGTCAAAGCTTGTAAGAAAGATCTCTGAAACATCATAGACTCCATTCGTACTTTACCATAAGAACGATTTCCACCAATCTTCAAGGGTTTTGATTTGTGATTCGGTGCTTAATTTGATAGGATATTGCAGATTTTGAGCTAAATCAGCTACAAACGACAGATACTTACAAGTTACAATATGACTGGTACCTGATTGATAAAAATCAAAGTTTTCAAATTTGGTCCTTTTTATTATGGCTT...

CDS

Download CDS FASTA

1233 bp · TkA03G010690|TK1151|CDS

ATGGCTTCTGGTGCAATGGCTCCTACTCAAGTTGAAAAATCCGGTGCAAATTCAATGTTTGTTGATAAACTGCCTGAGGGAATCAATGAAATGACAATCAAAGACGACAAAGTCGAAAAGGAAATGGAGGCAACTGTGGTAGATGGAAATGGGACTGAAACTGGTCATATTATTGTTACAACTATTGGAGGTAGAAATGGTCAACCTAAACAGACAATAAGCTATATGGCAGAACGGGTCGTGGGCCAGGGTTCTTTTGG...

Protein

Download Protein FASTA

410 aa · TkA03G010690|TK1151|PROTEIN

MASGAMAPTQVEKSGANSMFVDKLPEGINEMTIKDDKVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPETAYRVARHYSKANQRMPMIYVKLYTYQIFRSLAYIHAIGVCHRDIKPQNLLVNPHSHQLKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTSAIDIWS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G010690`
TK1151 ID	TkA03G010690
OH-1004 ID	LXL04_006135
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G010690

Location Chr03:2712811-2719170 (-)

Description Similar to ASK5: Shaggy-related protein kinase epsilon

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14640`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At5g26751`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At3g05840`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006135 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006972 hyperosmotic response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0016310 phosphorylation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005938 cell cortex Cellular Component

KEGG gene cross-reference

ath:AT3G05840

ath:AT5G14640

ath:AT5G26751

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.574

Rank 1 · TkA03G010690 · TK1151

Nucleus0.548

Rank 2 · TkA03G010690 · TK1151

Cell membrane0.074

Rank 3 · TkA03G010690 · TK1151

Mitochondrion0.044

Rank 4 · TkA03G010690 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA03G010690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23720DUF716120-46 aa

PF03109ABC169-105 aa

PF00069Pkinase76-358 aa

PF14531Kinase-like76-121 aa

PF07714PK_Tyr_Ser-Thr78-276 aa

PF06293Kdo115-219 aa

PF01636APH115-160 aa

PF03109ABC1148-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G010690	`PF23720`	DUF7161	20	46	0.28	11.8
TkA03G010690	`PF03109`	ABC1	69	105	5.1e-06	26.5
TkA03G010690	`PF00069`	Pkinase	76	358	1.1e-62	212.5
TkA03G010690	`PF14531`	Kinase-like	76	121	5.4e-05	23.3
TkA03G010690	`PF07714`	PK_Tyr_Ser-Thr	78	276	9.6e-25	88.1
TkA03G010690	`PF06293`	Kdo	115	219	0.0059	16.8
TkA03G010690	`PF01636`	APH	115	160	0.18	12.2
TkA03G010690	`PF03109`	ABC1	148	224	5.1e-06	26.5
TkA03G010690	`PF01633`	Choline_kinase	172	220	0.04	14.0
TkA03G010690	`PF14531`	Kinase-like	177	264	5.4e-05	23.3
TkA03G010690	`PF01636`	APH	193	211	0.18	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZD5`	Arabidopsis thaliana	sp\|Q8VZD5\|KSG5_ARATH Shaggy-related protein kinase epsilon	87.100%	Swiss-Prot	High
`P43288`	Arabidopsis thaliana	sp\|P43288\|KSG1_ARATH Shaggy-related protein kinase alpha	84.900%	Swiss-Prot	High
`P43289`	Arabidopsis thaliana	sp\|P43289\|KSG3_ARATH Shaggy-related protein kinase gamma	83.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card