TkA03G010330 | RubberDandelionOmics

Gene overview

TkA03G010330

Reference: TK1151 Chr: Chr03 Coordinates: 2587717-2593445 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2393 bp · TkA03G010330|TK1151|cDNA

TCTCTGAATTTTGAATGATTTGGTGGCTCAAAACCGTGTGAAATCGTCTCTACACCTTTGACTCGCTACCCATTTTCTCACTTGATTCACCTTCTTCCTCCATTTATAGTTTTATGCTTCACAATCAAACACTTTCATGATCAACAAATCCTCCTCACAAACACCATGGCCACCGGAAAATCGAGATCTGAAATACAGATACATCTTCGCCAATTAAACGGCAAACGTATGGTTTTCTCCCTCCTTTTCTTCCTAGCTCT...

CDS

Download CDS FASTA

1161 bp · TkA03G010330|TK1151|CDS

ATGATTGCATCTTTTGCGGGTTATGCAGCATTTGTAAGAATATCAAAGCGTAGAGAAGAGAGGAAAAACATGGGACTACTATCAAACTCATTCAACAAAGCGGGATTGAAGTACAAATACGAAACACTCGAAAAGTCAACAAATTACTTTGACATTTCCAACAAATTAGGGCAAGGGGGTGCGGGGTCCGTGTACAAAGGGACTCTTCCTAGTGGAGATGTTGTGGCGGTTAAAAGGTTGTTTTTCAATACAAGGCAGTG...

Protein

Download Protein FASTA

386 aa · TkA03G010330|TK1151|PROTEIN

MIASFAGYAAFVRISKRREERKNMGLLSNSFNKAGLKYKYETLEKSTNYFDISNKLGQGGAGSVYKGTLPSGDVVAVKRLFFNTRQWVDEFFNEVNLISAIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDHFLFDKDKLQILSWKRRMGVILGTAEGLAYLHGGCHVRIIHRDIKSSNILLDKDFNSKIADFGLVRTFGADRSHLTTGIAGTLGYMAPEYIVRGQLTEKADVFSFGVVVLEIACGKRNNAFVEDSGSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G010330`
TK1151 ID	TkA03G010330
OH-1004 ID	LXL04_006115
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 57.765 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G010330

Location Chr03:2587717-2593445 (-)

Description Similar to CRK42: Cysteine-rich receptor-like protein kinase 42

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40380`	Cysteine-rich receptor-like protein kinase 42.	No verified direct reference in this release
`At1g70530`	Cysteine-rich receptor-like protein kinase 3.	No verified direct reference in this release
`At1g19090`	Cysteine-rich receptor-like protein kinase 1.	No verified direct reference in this release
`At1g70520`	Cysteine-rich receptor-like protein kinase 2.	No verified direct reference in this release
`At4g04570`	Cysteine-rich receptor-like protein kinase 40.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006115 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0010193 response to ozone Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0052545 callose localization Biological Process

GO:0072593 reactive oxygen species metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G19090

ath:AT1G70520

ath:AT1G70530

ath:AT4G28670

ath:AT5G40380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.708

Rank 1 · TkA03G010330 · TK1151

Cytoplasm0.213

Rank 2 · TkA03G010330 · TK1151

Nucleus0.154

Rank 3 · TkA03G010330 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA03G010330 · TK1151

Golgi apparatus0.033

Rank 5 · TkA03G010330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase51-250 aa

PF07714PK_Tyr_Ser-Thr52-318 aa

PF03109ABC161-80 aa

PF03109ABC1160-202 aa

PF17667Pkinase_fungal168-237 aa

PF14531Kinase-like168-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G010330	`PF00069`	Pkinase	51	250	2.8e-43	148.9
TkA03G010330	`PF07714`	PK_Tyr_Ser-Thr	52	318	1.9e-44	152.6
TkA03G010330	`PF03109`	ABC1	61	80	0.00033	20.6
TkA03G010330	`PF03109`	ABC1	160	202	0.00033	20.6
TkA03G010330	`PF17667`	Pkinase_fungal	168	237	0.03	13.8
TkA03G010330	`PF14531`	Kinase-like	168	249	0.054	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNE1`	Arabidopsis thaliana	sp\|Q9FNE1\|CRK42_ARATH Cysteine-rich receptor-like protein kinase 42	61.300%	Swiss-Prot	High
`Q9CAL2`	Arabidopsis thaliana	sp\|Q9CAL2\|CRK3_ARATH Cysteine-rich receptor-like protein kinase 3	60.400%	Swiss-Prot	High
`Q9LMB9`	Arabidopsis thaliana	sp\|Q9LMB9\|CRK1_ARATH Cysteine-rich receptor-like protein kinase 1	59.900%	Swiss-Prot	High
`Q9CAL3`	Arabidopsis thaliana	sp\|Q9CAL3\|CRK2_ARATH Cysteine-rich receptor-like protein kinase 2	52.400%	Swiss-Prot	High
`Q9SYS3`	Arabidopsis thaliana	sp\|Q9SYS3\|CRK40_ARATH Cysteine-rich receptor-like protein kinase 40	46.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card