TkA03G009260 | RubberDandelionOmics

Gene overview

TkA03G009260

Reference: TK1151 Chr: Chr03 Coordinates: 2301434-2301853 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · TkA03G009260|TK1151|cDNA

ATGTTTTTACTTGAACAATTATCATCTACATCTGTAACTGCCCTGGGAGCGATTTCTTCGGCTGAAATCGGGATCAGGGCAGTTGTGGAGACGATAGAAGAAGGTTCGAAGCAAAGTAGGGAGTATGCAGTGGGAGTGCTATTAATGATATGTGAGAGTAGCAGGGAGAGATATAGAGGAATGATTTTATGTGAAGGAGCGATTCCCGGGTTGCTTCAGCTAAGTCTCGATGGGACACAACGAGCTAGAGGGACTGCTAA...

CDS

Download CDS FASTA

420 bp · TkA03G009260|TK1151|CDS

ATGTTTTTACTTGAACAATTATCATCTACATCTGTAACTGCCCTGGGAGCGATTTCTTCGGCTGAAATCGGGATCAGGGCAGTTGTGGAGACGATAGAAGAAGGTTCGAAGCAAAGTAGGGAGTATGCAGTGGGAGTGCTATTAATGATATGTGAGAGTAGCAGGGAGAGATATAGAGGAATGATTTTATGTGAAGGAGCGATTCCCGGGTTGCTTCAGCTAAGTCTCGATGGGACACAACGAGCTAGAGGGACTGCTAA...

Protein

Download Protein FASTA

139 aa · TkA03G009260|TK1151|PROTEIN

MFLLEQLSSTSVTALGAISSAEIGIRAVVETIEEGSKQSREYAVGVLLMICESSRERYRGMILCEGAIPGLLQLSLDGTQRARGTAKSLLRLLRDCDGGDGSGGERLKNVVLEEVMGEIYREGTEVGMLEEMIARLTTT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G009260`
TK1151 ID	TkA03G009260
OH-1004 ID	LXL04_006100
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 41.994 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G009260`
Location	Chr03:2301434-2301853 (+)
Description	Similar to PUB3: U-box domain-containing protein 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006100` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016567 protein ubiquitination Biological Process GO:0034614 cellular response to reactive oxygen species Biological Process GO:0048364 root development Biological Process GO:0048658 anther wall tapetum development Biological Process GO:1904821 chloroplast disassembly Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0004842 ubiquitin-protein transferase activity Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function GO:0070696 transmembrane receptor protein serine/threonine kinase binding Molecular Function
KEGG gene cross-reference	ath:AT1G24330 ath:AT1G27910 ath:AT1G67530 ath:AT2G23140 ath:AT3G54790 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.569

Rank 1 · TkA03G009260 · TK1151

Nucleus0.484

Rank 2 · TkA03G009260 · TK1151

Cell membrane0.064

Rank 3 · TkA03G009260 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA03G009260 · TK1151

Mitochondrion0.041

Rank 5 · TkA03G009260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25598ARM_PUB17-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G009260	`PF25598`	ARM_PUB	17	95	0.009	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card