RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G007580
Reference: TK1151 Chr: Chr03 Coordinates: 1822551-1826099 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2076 bp · TkA03G007580|TK1151|cDNA

TTTCTTTCATTTTCTCTTTACAAAAAGCTGAAAAAAGGTCGAATACACAGTGTTATATTTCCCTCCAATGATAAGTACTTGCCGAAGAAACAGACCTTCTCCTTATCCTCCTCCTCGCACACAAACTGAACGCCACCAACAAAAATATCCCCATCAAACACACTCCAAAATCTTCACAATTTGCCCTACAAATTCTTCAATTTTAATCGGAACCTCAAAACCCCTAACCCTAAATTCCCATTTTCCCTCTTACATGAACC...

CDS

Download CDS FASTA

852 bp · TkA03G007580|TK1151|CDS

ATGGACGTCGCTTATCTACAGCAAACCAAATGCATATTCAGTTTCAATCCGATTCACTCTTCCACTCACAACCGCCGTGTTTCTGTTCCTTCTAAGTTACCAATCATAAATTCGAGGGATTACCAGCATAATGCTCGTCGTTCGTTTCGTCGGGGGAGTCGGAACATGTGTTTGGCTTCCAGCTCAGATACACTTGTCTCCGGGAAGTCGTCTTCTCCTACTGTTGCTAGTAAGAAGGAAAATGAGCTTGAGGAGGAAGA...

Protein

Download Protein FASTA

283 aa · TkA03G007580|TK1151|PROTEIN

MDVAYLQQTKCIFSFNPIHSSTHNRRVSVPSKLPIINSRDYQHNARRSFRRGSRNMCLASSSDTLVSGKSSSPTVASKKENELEEEEDLKSWMHKNGLPPCKVVLKDRPAYDSRHPSIHYVAASEDLKAGDVAFSVPSSLLVTLERVLGNETVAELLTTNKLSELACLALYLMYEKKQGKESFWYPYIKELDRQRGRGQLAVESPLLWSESELNYLTGSPIKAEVLERAEGIRKEYNELDTVWFMAGSYFSNIRLISLQR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G007580
TK1151 IDTkA03G007580
OH-1004 IDLXL04_006058
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)98.800
Protein coverage (%)TK1151 88.339 / OH-1004 48.077
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G007580
LocationChr03:1822551-1826099 (+)
DescriptionSimilar to SETD3: Actin-histidine N-methyltransferase
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_006058 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0018021 peptidyl-histidine methylation Biological Process
GO:0030047 actin modification Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process
GO:0070472 regulation of uterine smooth muscle contraction Biological Process
GO:0000785 chromatin Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005654 nucleoplasm Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0003713 transcription coactivator activity Molecular Function
GO:0003779 actin binding Molecular Function
GO:0016279 protein-lysine N-methyltransferase activity Molecular Function
KEGG gene cross-reference
cjc:100403104
dnm:101422009
hsa:84193
panu:100137585
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.977
Rank 1 · TkA03G007580 · TK1151
Nucleus0.031
Rank 2 · TkA03G007580 · TK1151
Mitochondrion0.024
Rank 3 · TkA03G007580 · TK1151
Cytoplasm0.020
Rank 4 · TkA03G007580 · TK1151
Peroxisome0.013
Rank 5 · TkA03G007580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser