TkA03G007400 | RubberDandelionOmics

Gene overview

TkA03G007400

Reference: TK1151 Chr: Chr03 Coordinates: 1767077-1770020 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · TkA03G007400|TK1151|cDNA

CTCGACCGTTTTCTTCTTCTTCCCTCCCCATTTCTAAACCTCACCGCATTTCCCCACTCCTCGCTCACTTTCAGACCACACACACCGTTTCCATTTCAGACTCACAGAACTGATAACCACATCAAAACCAAAAACTCCATTGCATCTTTGCATACATATTACATATATACATAACAGAGGGGTTTTGATTTTCGAACGTTTGATTAAGTTAAAATGGGGACGATATACAAACACATGTTAATGGCGAACAACAAAAAGGG...

CDS

Download CDS FASTA

870 bp · TkA03G007400|TK1151|CDS

ATGGGGACGATATACAAACACATGTTAATGGCGAACAACAAAAAGGGGGATTTAGGACATGTTTGGATGGCTGCTCATTTCCCGCACCGTATCAGGAAAGAATATGTTCAACAGACCAACATCAGTTCTTCTGTCGATAAAATACTGGTAGACCAACTTCCAGTTGTAACCTATAGAATCTTGGGGTTTCTTCTTTTAGGAATAACAAGGTTATACTCCAAAAAAGTTGAGTATTTGCTTATTGACTGCAATCATAGTCT...

Protein

Download Protein FASTA

290 aa · TkA03G007400|TK1151|PROTEIN

MGTIYKHMLMANNKKGDLGHVWMAAHFPHRIRKEYVQQTNISSSVDKILVDQLPVVTYRILGFLLLGITRLYSKKVEYLLIDCNHSLYEMKVYTEGRKKVNINLGGMCIPESSSSQRSKSNGVDTNLPECSSRRKSNTIIDAMRAEFFSISLPENFELDAFDLEVVEDDSSNEHHVKSHLEIVLPDKWENDQTGHNSETSPENLRGRFSLEDCIVPMELDEPDEEVTLPKIPLVQQQDPESNNNNTNFLDNLMVFEDRND...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G007400`
TK1151 ID	TkA03G007400
OH-1004 ID	LXL04_034223
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	31.700
Protein coverage (%)	TK1151 84.483 / OH-1004 30.975 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G007400

Location Chr03:1767077-1770020 (+)

Description Similar to SYN3: Sister chromatid cohesion 1 protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40840`	May be involved in sister chromatid cohesion during mitosis.	No verified direct reference in this release
`At5g16270`	Involved in sister chromatid and centromere cohesion during mitosis.	Cohesin gene defects may impair sister chromatid alignment and genome stability in Arabidopsis thaliana.2009 · DOI: 10.1007/s00412-009-0220-x
`At3g59550`	May be involved in sister chromatid cohesion during mitosis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034223 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0007064 mitotic sister chromatid cohesion Biological Process

GO:0008015 blood circulation Biological Process

GO:0009555 pollen development Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0051301 cell division Biological Process

GO:0070601 centromeric sister chromatid cohesion Biological Process

KEGG gene cross-reference

ath:AT3G59550

ath:AT5G16270

dre:322275

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · TkA03G007400 · TK1151

Cytoplasm0.158

Rank 2 · TkA03G007400 · TK1151

Cell membrane0.017

Rank 3 · TkA03G007400 · TK1151

Mitochondrion0.010

Rank 4 · TkA03G007400 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA03G007400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04825Rad21_Rec8_N5-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G007400	`PF04825`	Rad21_Rec8_N	5	98	8.7e-21	74.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FQ20`	Arabidopsis thaliana	sp\|Q9FQ20\|SCC12_ARATH Sister chromatid cohesion 1 protein 2	39.000%	Swiss-Prot	Medium
`Q8W1Y0`	Arabidopsis thaliana	sp\|Q8W1Y0\|SSC14_ARATH Sister chromatid cohesion 1 protein 4	34.200%	Swiss-Prot	Medium
`Q9FQ19`	Arabidopsis thaliana	sp\|Q9FQ19\|SCC13_ARATH Sister chromatid cohesion 1 protein 3	31.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card