TkA03G003170 | RubberDandelionOmics

Gene overview

TkA03G003170

Reference: TK1151 Chr: Chr03 Coordinates: 766349-768403 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1970 bp · TkA03G003170|TK1151|cDNA

AATCACTACCCGCCAACTCCATTCGTTTGTCTTGTATTATCTCACTCTCACCTCCCTTCCGCCATTAAAAGACCACCCACCATAGCCTCAGCTTCAAACTTTCGTGGGCCAACCATCCATGCACAATGATACATGCCGCCATGGGTACTTCCTTGCAGAATGACATGAACACCCTAATCACAGAAAGCTCTTGCTTAAAGCTCAATCCAACCTCTCCCCTCCACGATGACACCAAGAAAAATCCCCCACCACCGCAACTT...

CDS

Download CDS FASTA

1845 bp · TkA03G003170|TK1151|CDS

ATGATACATGCCGCCATGGGTACTTCCTTGCAGAATGACATGAACACCCTAATCACAGAAAGCTCTTGCTTAAAGCTCAATCCAACCTCTCCCCTCCACGATGACACCAAGAAAAATCCCCCACCACCGCAACTTCCTCCCTCTTCCGCCCTTAAGATGGAGGATATGGAAATCCAATCTCCCGACTTGTGGGAATCCTTCTTCTCCGAGCAACTTCAGGAGGCGGACTTCATGATCTCCTCCCCTGTCCCTTCAAATTT...

Protein

Download Protein FASTA

615 aa · TkA03G003170|TK1151|PROTEIN

MIHAAMGTSLQNDMNTLITESSCLKLNPTSPLHDDTKKNPPPPQLPPSSALKMEDMEIQSPDLWESFFSEQLQEADFMISSPVPSNFNYYPSPLAPFNNNSKPKGMSPLQRVFSNCNSPNNQFMQVETISLPALENFLDDLEQDDDYLSYSTTGVASADQSYDSLTTIPALLDCLTLPSPSRFYGEATTSAIHGAAIGGSSADNDQMYHQPRPAVSNAPLMEQLEQERREEKQHRQQHRQHLPSPSPLQPQPINHNHLMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G003170`
TK1151 ID	TkA03G003170
OH-1004 ID	LXL04_006035
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 95.944 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G003170

Location Chr03:766349-768403 (+)

Description Similar to RAM1: GRAS family protein RAM1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54220`	Transcription factor required for quiescent center cells specification and maintenance of surrounding stem cells, and for the asymmetric cell division involved in radial pattern formation in roots.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006035 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007584 response to nutrient Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0010247 detection of phosphate ion Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

mtr:11438339

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.891

Rank 1 · TkA03G003170 · TK1151

Cytoplasm0.167

Rank 2 · TkA03G003170 · TK1151

Cell membrane0.043

Rank 3 · TkA03G003170 · TK1151

Endoplasmic reticulum0.038

Rank 4 · TkA03G003170 · TK1151

Plastid0.022

Rank 5 · TkA03G003170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03514GRAS275-615 aa

PF02624YcaO364-446 aa

PF30722DUF8704523-584 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G003170	`PF03514`	GRAS	275	615	4.5e-119	398.4
TkA03G003170	`PF02624`	YcaO	364	446	0.13	12.3
TkA03G003170	`PF30722`	DUF8704	523	584	0.042	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M384`	Arabidopsis thaliana	sp\|Q9M384\|SCR_ARATH Protein SCARECROW	43.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card