TkA02G610550 | RubberDandelionOmics

Gene overview

TkA02G610550

Reference: TK1151 Chr: Chr02 Coordinates: 157516207-157517890 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1389 bp · TkA02G610550|TK1151|cDNA

ATGAAGAAGTATAATGTTGGTTTCTCTAAGCACAAAATTTTCAGAGCAAAAGCTAAAGCAAAAAAATATGTGGTGGGTGATTGCTCAAAACAGTATGAACTTCTTAGGGACTATGCCCTAGAGTTGCAGTCAACCAATCCTGATACCACAGTGAAGCTGGAGAAGGGTTTTAGAGCATGTCTAAGAGATTTTTTGGGGTTAGATGGGACTCACCTGAAGGGTGCATACACAGGTCAAATTTTGACAGCAGTTGGAGTAGA...

CDS

Download CDS FASTA

1389 bp · TkA02G610550|TK1151|CDS

ATGAAGAAGTATAATGTTGGTTTCTCTAAGCACAAAATTTTCAGAGCAAAAGCTAAAGCAAAAAAATATGTGGTGGGTGATTGCTCAAAACAGTATGAACTTCTTAGGGACTATGCCCTAGAGTTGCAGTCAACCAATCCTGATACCACAGTGAAGCTGGAGAAGGGTTTTAGAGCATGTCTAAGAGATTTTTTGGGGTTAGATGGGACTCACCTGAAGGGTGCATACACAGGTCAAATTTTGACAGCAGTTGGAGTAGA...

Protein

Download Protein FASTA

462 aa · TkA02G610550|TK1151|PROTEIN

MKKYNVGFSKHKIFRAKAKAKKYVVGDCSKQYELLRDYALELQSTNPDTTVKLEKGFRACLRDFLGLDGTHLKGAYTGQILTAVGVDSNNGIYPLAYAIVEIENFQSWKWFLTCLGDDLELDSMSNFTFMSDRQKGLKNAIEQLFPCAEHRYCLRHIHQNMRRWWPTKEYKDHLWKCATASTVPEFNHLMNELSIYDKSAYEYLKKISPQHWTRSHFSGRATTDMLLNNICEVFNGKLVDGRDKPIITCLEFIREYMMKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G610550`
TK1151 ID	TkA02G610550
OH-1004 ID	LXL04_000461
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	87.400
Protein coverage (%)	TK1151 100.000 / OH-1004 46.956 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G610550`
Location	Chr02:157516207-157517890 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000461` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.869

Rank 1 · TkA02G610550 · TK1151

Cytoplasm0.164

Rank 2 · TkA02G610550 · TK1151

Cell membrane0.031

Rank 3 · TkA02G610550 · TK1151

Mitochondrion0.026

Rank 4 · TkA02G610550 · TK1151

Endoplasmic reticulum0.026

Rank 5 · TkA02G610550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10551MULE65-160 aa

PF00872Transposase_mut79-172 aa

PF13877RPAP3_C182-235 aa

PF18284DNA_meth_N193-216 aa

PF04434SWIM315-343 aa

PF13696zf-CCHC_2385-390 aa

PF13696zf-CCHC_2446-457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G610550	`PF10551`	MULE	65	160	6.1e-21	75.3
TkA02G610550	`PF00872`	Transposase_mut	79	172	4e-06	26.7
TkA02G610550	`PF13877`	RPAP3_C	182	235	0.25	12.6
TkA02G610550	`PF18284`	DNA_meth_N	193	216	0.047	14.5
TkA02G610550	`PF04434`	SWIM	315	343	3.9e-10	39.7
TkA02G610550	`PF13696`	zf-CCHC_2	385	390	0.18	12.3
TkA02G610550	`PF13696`	zf-CCHC_2	446	457	0.18	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card