TkA02G609130 | RubberDandelionOmics

Gene overview

TkA02G609130

Reference: TK1151 Chr: Chr02 Coordinates: 157096361-157101527 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2356 bp · TkA02G609130|TK1151|cDNA

AATAAACTGCCAGCATGAAGCTGGGAAAAATACAGATACACCAAAATGAGCATACCAGAATACCACCATTGATACTACATGCAACCAAAAATTGAAAAAACAACACCAAAATAAGCACCTACTAAAATTACAAGGACTTAAGAATATGAAGGGCAGATTGGAATCTTCAAAGCAGCAAGGATAATTTTACTTGCATTGTTTTCCTAAAATACCCTTTTCAGAATAAAGACACAACTGGCTTACAACAGAGCAGCAGGGAT...

CDS

Download CDS FASTA

1863 bp · TkA02G609130|TK1151|CDS

ATGAAGTTCTCCGGAATTGTCGGCAATCACCGCCATCTCTACCGTCTCCAGAAGTCTTTAATTGCTGCTGGTAGCAGGAAACTTCAAAATGATTTAGGGATTAAGCGTAACTTGTCAGGATTGATCTCGGAAGAAGAGTCAGAACTTAAAGAATTTAATAATTATCTGGATAATCTGAAGAACCATGAAAAATCTGGTGTTCCAAAGGGCGCTGGAACCGACTCAGATGATGGTTTTGATCTTGGAAGAATGAAACGACT...

Protein

Download Protein FASTA

620 aa · TkA02G609130|TK1151|PROTEIN

MKFSGIVGNHRHLYRLQKSLIAAGSRKLQNDLGIKRNLSGLISEEESELKEFNNYLDNLKNHEKSGVPKGAGTDSDDGFDLGRMKRLMQLLGNPHSTFKAVHIAGTKGKGSTAAFLSNILRAEGYSVGCYTSPHIKTIRERITLGRFGDPVSAKTVNSLFQRIKLVLDEAVQLEKGHLSHFEVLTAVAFNLFAEENVDIAVVEAGLGGARDATNIISSSNLAASIITTIGEEHLAALGGSLETITIAKSGIIKHGRPVVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G609130`
TK1151 ID	TkA02G609130
OH-1004 ID	LXL04_011844
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.000
Protein coverage (%)	TK1151 96.290 / OH-1004 36.651 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G609130

Location Chr02:157096361-157101527 (+)

Description Similar to DHFS: Dihydrofolate synthetase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41480`	Conversion of folates to polyglutamate derivatives, including tetrahydrofolate.	Tetrahydrofolate biosynthesis in plants: molecular and functional characterization of dihydrofolate synthetase and three isoforms of folylpolyglutamate synthetase in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.261585098 The GLOBULAR ARREST1 gene, which is involved in the biosynthesis of folates, is essential for embryogenesis in Arabidopsis thaliana.2003 · DOI: 10.1046/j.1365-313x.2003.01621.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011844 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006508 proteolysis Biological Process

GO:0006730 one-carbon metabolic process Biological Process

GO:0009396 folic acid-containing compound biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0015074 DNA integration Biological Process

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0071897 DNA biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0042575 DNA polymerase complex Cellular Component

GO:0003676 nucleic acid binding Molecular Function

KEGG gene cross-reference

ath:AT5G41480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.514

Rank 1 · TkA02G609130 · TK1151

Mitochondrion0.479

Rank 2 · TkA02G609130 · TK1151

Cytoplasm0.099

Rank 3 · TkA02G609130 · TK1151

Nucleus0.046

Rank 4 · TkA02G609130 · TK1151

Peroxisome0.045

Rank 5 · TkA02G609130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08245Mur_ligase_M103-348 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G609130	`PF08245`	Mur_ligase_M	103	348	1.7e-10	41.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JYE9`	Arabidopsis thaliana	sp\|F4JYE9\|DHFS_ARATH Dihydrofolate synthetase	59.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card