TkA02G603720 | RubberDandelionOmics

Gene overview

TkA02G603720

Reference: TK1151 Chr: Chr02 Coordinates: 155664811-155666412 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

862 bp · TkA02G603720|TK1151|cDNA

CTCTAACAGGCCTCGCGAACGGGCTTTAAACTTAGAGTCAAGTCCATCAGCAGAAAACACTTGGTGAGTAACTAGGGTTTTCTCTGCATCAAAAGAACCCACCCTTCATTCCTGCCCGTCTATCTCTCTCGAAGCAGCAGCCATGATTATCCCTGAGAAGAATCGTAAGGCGATATCCAAATATCTCTTCCAAGAGGGAGTATGCTATGCTAAGAAGGATTACAATCTGGCCAAGCATCCAGATATCGATGTGCCTAATT...

CDS

Download CDS FASTA

543 bp · TkA02G603720|TK1151|CDS

ATGATTATCCCTGAGAAGAATCGTAAGGCGATATCCAAATATCTCTTCCAAGAGGGAGTATGCTATGCTAAGAAGGATTACAATCTGGCCAAGCATCCAGATATCGATGTGCCTAATTTGCAGGTGATTAAGCTTATGCAAAGCTTCAAATCCAAGGAATACGTTCGTGAGACATTCGCCTGGATGCATTACTATTGGTATCTCACTAATGACGGTATCGAGTTCTTGAGAACTTATTTGAACCTTCCATCTGATATCGT...

Protein

Download Protein FASTA

180 aa · TkA02G603720|TK1151|PROTEIN

MIIPEKNRKAISKYLFQEGVCYAKKDYNLAKHPDIDVPNLQVIKLMQSFKSKEYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSDIVPATLKKSAKPLGRPTGGPPGDRPRGPPRFEGDRPRFGDRDGYRGGPRGPPGEFGGEKGGAPADYQPAFNRGDGARPSFGRGGGGYGAPSSSFA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G603720`
TK1151 ID	TkA02G603720
OH-1004 ID	LXL04_011921
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G603720

Location Chr02:155664811-155666412 (+)

Description Similar to RPS10-2: 40S ribosomal protein S10-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25740`	Small ribosomal subunit protein eS10z.	No verified direct reference in this release
`At5g52650`	Small ribosomal subunit protein eS10x.	No verified direct reference in this release
`At5g41520`	Small ribosomal subunit protein eS10y.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0549600`	Small ribosomal subunit protein eS10z.	No verified direct reference in this release
`Os04g0430100`	Small ribosomal subunit protein eS10y.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011921 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0090506 axillary shoot meristem initiation Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G25740

ath:AT5G41520

ath:AT5G52650

dosa:Os02g0549600

dosa:Os04g0430100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.697

Rank 1 · TkA02G603720 · TK1151

Nucleus0.482

Rank 2 · TkA02G603720 · TK1151

Endoplasmic reticulum0.050

Rank 3 · TkA02G603720 · TK1151

Mitochondrion0.034

Rank 4 · TkA02G603720 · TK1151

Cell membrane0.033

Rank 5 · TkA02G603720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03501S10_plectin3-94 aa

PF03852Vsr9-43 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G603720	`PF03501`	S10_plectin	3	94	6.7e-43	145.4
TkA02G603720	`PF03852`	Vsr	9	43	0.094	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SW09`	Arabidopsis thaliana	sp\|Q9SW09\|RS101_ARATH Small ribosomal subunit protein eS10z	69.000%	Swiss-Prot	High
`Q9LTF2`	Arabidopsis thaliana	sp\|Q9LTF2\|RS103_ARATH Small ribosomal subunit protein eS10x	76.700%	Swiss-Prot	High
`Q9FFS8`	Arabidopsis thaliana	sp\|Q9FFS8\|RS102_ARATH Small ribosomal subunit protein eS10y	64.000%	Swiss-Prot	High
`P0DKK8`	Oryza sativa subsp. japonica	sp\|P0DKK8\|RS10A_ORYSJ Small ribosomal subunit protein eS10z	67.300%	Swiss-Prot	High
`P0DKK9`	Oryza sativa subsp. japonica	sp\|P0DKK9\|RS10B_ORYSJ Small ribosomal subunit protein eS10y	67.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card