Gene Card
Gene overview
cDNA / CDS / Protein Sequences
10370 bp · TkA02G600950|TK1151|cDNA
CATCTTTATTAAAGATGAACATATTTTGTAATTATTCAATTTTCCATTTTTGTATAGAAATTAGACTTTGCTACTAAAAGTTTCGTGACCAATTGTTGGGCTACACCCATTTAGTAGGCCCATAAGTATGTATAGGGTAGATAAATACGAAACCCTAACACATAACTCCTACTTCCAAACTAATGACATAACAATCTGAAAACATCACCCCCAAAACAGAAGACTCAATGGCAACGGCATCTACTTTGATCGCGTGTATG...
498 bp · TkA02G600950|TK1151|CDS
ATGAAAAAGAAATCGCCAATCATGCCTAATTTGAAGCAAATCAAAGCAGATTTCTTATATATCCTAATCGATCGCTTCATGATTTCTTTACAGACAGAAACAGAGCCATGTGAGGTGAAACCTGCAGAAGGTGTTCCGCCTCCTACTTGCATTGTTGCAACAACCACACATCCCCTTCTCCGGCAACGATGCCCCATGGTGTTTCTTGGGATAATTTTGAACTGGTGCACCTGGAATAGGAAAACTCTACTTGCCGTGGA...
Protein
Download Protein FASTA165 aa · TkA02G600950|TK1151|PROTEIN
MKKKSPIMPNLKQIKADFLYILIDRFMISLQTETEPCEVKPAEGVPPPTCIVATTTHPLLRQRCPMVFLGIILNWCTWNRKTLLAVDEELQNQMEQDYGIRGSFVTVGAAVCCGILACFLGGVAAFSTAVFWRGNFNGGKVGGEQGEQPPKCKQQPYWKRYWSGD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G600950 |
|---|---|
| TK1151 ID | TkA02G600950 |
| OH-1004 ID | LXL04_011942 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 51.100 |
| Protein coverage (%) | TK1151 93.939 / OH-1004 63.772Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G600950 |
|---|---|
| Location | Chr02:154948250-154960841 (-) |
| Description | Similar to NAP1;2: Nucleosome assembly protein 1;2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006334 nucleosome assembly Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003682 chromatin binding Molecular Function GO:0042393 histone binding Molecular Function |
| KEGG gene cross-reference | dosa:Os05g0539700 osa:4339460 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.