TkA02G600540 | RubberDandelionOmics

Gene overview

TkA02G600540

Reference: TK1151 Chr: Chr02 Coordinates: 154851744-154852136 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · TkA02G600540|TK1151|cDNA

ATGGGTTCTGAAATACGTGAAGCAAACAAGTCCAGTCGCATATGGCTTGGTTCTTATCCAACACCGGAGATGGCAGCTGCCGCCTACGACGTCGCTGCATTGGCTGTGAAAGGTAAGTACGCAGTCCTAAACTTTCCAGACTCCGCTATCTCAAACACGCTTCGGAGTGTCCGACAGCCGATGATATCCGTGCTACAGCTGCCAGAGCAGCCGCCAGTCGATCGGCAACTTATGACTATGGTAGAGGTACATATACAGCT...

CDS

Download CDS FASTA

357 bp · TkA02G600540|TK1151|CDS

ATGGGTTCTGAAATACGTGAAGCAAACAAGTCCAGTCGCATATGGCTTGGTTCTTATCCAACACCGGAGATGGCAGCTGCCGCCTACGACGTCGCTGCATTGGCTGTGAAAGGTAAGTACGCAGTCCTAAACTTTCCAGACTCCGCTATCTCAAACACGCTTCGGAGTGTCCGACAGCCGATGATATCCGTGCTACAGCTGCCAGAGCAGCCGCCAGTCGATCGGCAACTTATGACTATGGTAGAGGTACATATACAGCT...

Protein

Download Protein FASTA

118 aa · TkA02G600540|TK1151|PROTEIN

MGSEIREANKSSRIWLGSYPTPEMAAAAYDVAALAVKGKYAVLNFPDSAISNTLRSVRQPMISVLQLPEQPPVDRQLMTMVEVHIQLGQVCTWTTKQCLGCQICCRTWRMECFLVPEV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G600540`
TK1151 ID	TkA02G600540
OH-1004 ID	LXL04_011947
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.100
Protein coverage (%)	TK1151 44.068 / OH-1004 24.528 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G600540

Location Chr02:154851744-154852136 (-)

Description Similar to ERF025: Ethylene-responsive transcription factor ERF025

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63040`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g52020`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g11590`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g12630`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g25810`	Putative transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011947 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G25470

ath:AT4G25490

ath:AT5G51990

ath:AT5G52020

dosa:Os01g0968800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.566

Rank 1 · TkA02G600540 · TK1151

Cytoplasm0.374

Rank 2 · TkA02G600540 · TK1151

Mitochondrion0.079

Rank 3 · TkA02G600540 · TK1151

Cell membrane0.053

Rank 4 · TkA02G600540 · TK1151

Endoplasmic reticulum0.048

Rank 5 · TkA02G600540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP29-38 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G600540	`PF00847`	AP2	9	38	6.8e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAN9`	Arabidopsis thaliana	sp\|Q9CAN9\|ERF26_ARATH Ethylene-responsive transcription factor ERF026	76.100%	Swiss-Prot	Low
`Q9FJ90`	Arabidopsis thaliana	sp\|Q9FJ90\|ERF25_ARATH Ethylene-responsive transcription factor ERF025	73.500%	Swiss-Prot	Low
`Q9LYD3`	Arabidopsis thaliana	sp\|Q9LYD3\|DREB3_ARATH Dehydration-responsive element-binding protein 3	69.400%	Swiss-Prot	Low
`Q38Q39`	Arabidopsis thaliana	sp\|Q38Q39\|ERF27_ARATH Ethylene-responsive transcription factor ERF027	73.900%	Swiss-Prot	Low
`Q39127`	Arabidopsis thaliana	sp\|Q39127\|TINY_ARATH Ethylene-responsive transcription factor TINY	70.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card