TkA02G599620 | RubberDandelionOmics

Gene overview

TkA02G599620

Reference: TK1151 Chr: Chr02 Coordinates: 154613683-154616235 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

780 bp · TkA02G599620|TK1151|cDNA

ATGTGTCTCAAGTTGTGCGGGATCTGTTGCGGGAAATGCAAAGTATGTGTTCCATCGGGTCCGTACGCAATGGAAGATGTTCTGGAATTTAATCGTAGATGGATATTTGGGTTTGATCCTTCTTGTGCGGACTACCTAAAAGTTTTAATCGAATCTCTATTTAGCAATACCGCTTGTTTGCTTACAAAAATTCAGGATTTCACTTTAAGACCAAACATAGCAGATGATTGTTTCTTGCTGACTTCCAGATGCATTCGCTA...

CDS

Download CDS FASTA

780 bp · TkA02G599620|TK1151|CDS

ATGTGTCTCAAGTTGTGCGGGATCTGTTGCGGGAAATGCAAAGTATGTGTTCCATCGGGTCCGTACGCAATGGAAGATGTTCTGGAATTTAATCGTAGATGGATATTTGGGTTTGATCCTTCTTGTGCGGACTACCTAAAAGTTTTAATCGAATCTCTATTTAGCAATACCGCTTGTTTGCTTACAAAAATTCAGGATTTCACTTTAAGACCAAACATAGCAGATGATTGTTTCTTGCTGACTTCCAGATGCATTCGCTA...

Protein

Download Protein FASTA

259 aa · TkA02G599620|TK1151|PROTEIN

MCLKLCGICCGKCKVCVPSGPYAMEDVLEFNRRWIFGFDPSCADYLKVLIESLFSNTACLLTKIQDFTLRPNIADDCFLLTSRCIRYCLYLLLPSPVFSSLVECSMTGITVQHKLLFLVSVFSHMGQHYQNLTKFKIRNSKNSSVSFSDSMRFNGLTTRFVTFVTGGVCIAALSDAASGVDINGLTIPIQELSEVCRRNHTVQAMVQEALRQLEVNLVYILCHHHSIIIYYIHFIGGMENVIFVPDLYMGGVVYNCCNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G599620`
TK1151 ID	TkA02G599620
OH-1004 ID	LXL04_008578
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.800
Protein coverage (%)	TK1151 78.378 / OH-1004 25.130 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G599620

Location Chr02:154613683-154616235 (-)

Description Similar to MOS14: Transportin MOS14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62600`	Functions as a nuclear import receptor for serine-arginine rich (SR) proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008578 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006403 RNA localization Biological Process

GO:0006404 RNA import into nucleus Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0035719 tRNA import into nucleus Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0051031 tRNA transport Biological Process

GO:0061015 snRNA import into nucleus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005642 annulate lamellae Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G62600

hsa:23534

mmu:320938

sce:YOR160W

spo:2539916

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.413

Rank 1 · TkA02G599620 · TK1151

Nucleus0.330

Rank 2 · TkA02G599620 · TK1151

Mitochondrion0.207

Rank 3 · TkA02G599620 · TK1151

Endoplasmic reticulum0.116

Rank 4 · TkA02G599620 · TK1151

Cell membrane0.114

Rank 5 · TkA02G599620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02704GASA1-27 aa

PF02704GASA82-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G599620	`PF02704`	GASA	1	27	6e-05	23.8
TkA02G599620	`PF02704`	GASA	82	88	6e-05	23.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUL2`	Arabidopsis thaliana	sp\|Q8GUL2\|MOS14_ARATH Transportin MOS14	38.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card