TkA02G598890 | RubberDandelionOmics

Gene overview

TkA02G598890

Reference: TK1151 Chr: Chr02 Coordinates: 154414188-154415174 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

672 bp · TkA02G598890|TK1151|cDNA

ATTAAATCGAATCCGAGGCGGTCACTATCGTCAAGAGATTTTTCGCCTATAAGAAATTACCGATTAAAATCCTTCCATCTTCTCGCACTCTCTTCCCCAAGCTTCCATACTTGCAAATCTTGGTAACCTAGAACAGAGCTACGAATTCTTGATTCCTACTACCTTTGATCGTTGTATTTCCAATAGCGTTACAGCCCACAGTATACCCACATGGCGGAAAGCCCAATTTCAGATAAGGAGATGGGATCACTTGTTGTATG...

CDS

Download CDS FASTA

462 bp · TkA02G598890|TK1151|CDS

ATGGCGGAAAGCCCAATTTCAGATAAGGAGATGGGATCACTTGTTGTATGCTTTGGAGAAATGTTGATCGATTTTGTACCTTCGGTTGCTGGAGTCTCACTTGCAGAAGCACCGAAGTTTGAGAAAGCTCCTGGTGGTGCTCCGGCAAATGTTGCCGTCGGTATATCAAGACTGGGAGGTTCATCGGCGTTTATTGGCAAGGTGGGCGACGACCAATTCGGGTACATGTTGGCTGACATTTTGAAGAAAAACAACGTTAA...

Protein

Download Protein FASTA

153 aa · TkA02G598890|TK1151|PROTEIN

MAESPISDKEMGSLVVCFGEMLIDFVPSVAGVSLAEAPKFEKAPGGAPANVAVGISRLGGSSAFIGKVGDDQFGYMLADILKKNNVNNSGMRFDHKARTAIAFVSLKSDGEREFLFYRNPSADMLLQESELDVDLIKQVLSLLSFYFWLNAKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G598890`
TK1151 ID	TkA02G598890
OH-1004 ID	LXL04_011984
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.196 / OH-1004 41.194 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G598890

Location Chr02:154414188-154415174 (+)

Description Similar to At5g51830: Probable fructokinase-7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51830`	May play an important role in maintaining the flux of carbon towards starch formation.	No verified direct reference in this release
`At1g66430`	May play an important role in maintaining the flux of carbon towards starch formation.	No verified direct reference in this release
`At3g59480`	May play an important role in maintaining the flux of carbon towards starch formation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YQL4`	May play an important role in maintaining the flux of carbon towards starch formation in endosperm.	No verified direct reference in this release
`Os08g0113100`	May play an important role in maintaining the flux of carbon towards starch formation in endosperm.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011984 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006000 fructose metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0016051 carbohydrate biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008865 fructokinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G66430

ath:AT4G10260

ath:AT5G51830

dosa:Os08g0113100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.623

Rank 1 · TkA02G598890 · TK1151

Nucleus0.326

Rank 2 · TkA02G598890 · TK1151

Mitochondrion0.134

Rank 3 · TkA02G598890 · TK1151

Peroxisome0.114

Rank 4 · TkA02G598890 · TK1151

Plastid0.062

Rank 5 · TkA02G598890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00294PfkB14-139 aa

PF25991KhtT_N105-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G598890	`PF00294`	PfkB	14	139	6.4e-35	121.7
TkA02G598890	`PF25991`	KhtT_N	105	143	0.19	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLH8`	Arabidopsis thaliana	sp\|Q9FLH8\|SCRK7_ARATH Probable fructokinase-7	78.200%	Swiss-Prot	High
`Q9C524`	Arabidopsis thaliana	sp\|Q9C524\|SCRK6_ARATH Probable fructokinase-6, chloroplastic	80.600%	Swiss-Prot	High
`Q9M1B9`	Arabidopsis thaliana	sp\|Q9M1B9\|SCRK4_ARATH Probable fructokinase-4	71.200%	Swiss-Prot	High
`A2YQL4`	Oryza sativa subsp. indica	sp\|A2YQL4\|SCRK2_ORYSI Fructokinase-2	74.600%	Swiss-Prot	High
`Q0J8G4`	Oryza sativa subsp. japonica	sp\|Q0J8G4\|SCRK2_ORYSJ Fructokinase-2	74.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card