TkA02G593980 | RubberDandelionOmics

Gene overview

TkA02G593980

Reference: TK1151 Chr: Chr02 Coordinates: 153231319-153237338 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

735 bp · TkA02G593980|TK1151|cDNA

GAGACTTTTGTTAGGACTTTTCTCTGATACTAGAAACGTCGATCGATCAGTCGAATCAAGGCGAAAGAACATTTGTGTGAAAATGGCGAACATGCTTCGATGCCAGAGGATCGGCTGTAACGCTACTTTCACGGATGATGATAATCCCGAGGGCTCTTGCACATATCATGAGTCGATGCAAGACAGGCAAACACACAACAGAAAAACCAGTGATAGCAAAAAAGGCTTCTACCCCTGCCCCAAAGCAAGTTATCAAAACA...

CDS

Download CDS FASTA

684 bp · TkA02G593980|TK1151|CDS

ATGGATTATGTCTCTGAATCAGTTCCTTTAGACTTTAGTTATACATTGTCTAACATGTTTGTTTTTTGTGCATTGGCTTTGTTAATCAACCGGGAACTCTCATTAATCCAGGGACCTCTATTTCACGACGGTATGAAAGAGTGGAGCTGTTGCAAAAAAAGAAGTCATGATTTCACCTTATTCTTAGAAATCCCAGGATGCAAGACAGGCAAACACACAACAGAAAAACCAGTGATAGCAAAAAAGGCTTCTACCCCTGC...

Protein

Download Protein FASTA

227 aa · TkA02G593980|TK1151|PROTEIN

MDYVSESVPLDFSYTLSNMFVFCALALLINRELSLIQGPLFHDGMKEWSCCKKRSHDFTLFLEIPGCKTGKHTTEKPVIAKKASTPAPKQVIKTPTTNPITKESCPRCRQGFFCSDHGSQVKDMKPKPSYEAESTSEESVKVKVKASPVVKKVVDINEPQICKNKGCGQTFKEIDNHETACNYHPGPAVFHDRLRGWKCCDIHVKEFDEFMGIPPCAKGWHDAEAAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G593980`
TK1151 ID	TkA02G593980
OH-1004 ID	LXL04_012001
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 83.700 / OH-1004 86.364 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G593980

Location Chr02:153231319-153237338 (-)

Description Similar to RAR1: Cysteine and histidine-rich domain-containing protein RAR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51700`	Required specifically for plant innate immunity.	Regulatory role of SGT1 in early R gene-mediated plant defenses.2002 · DOI: 10.1126/science.1067747 Arabidopsis RAR1 exerts rate-limiting control of R gene-mediated defenses against multiple pathogens.2002 · DOI: 10.1105/tpc.001040 RAR1 and NDR1 contribute quantitatively to disease resistance in Arabidopsis, and their relative contributions are dependent on the R gene assayed.2002 · DOI: 10.1105/tpc.001032 Cytosolic HSP90 associates with and modulates the Arabidopsis RPM1 disease resistance protein.2003 · DOI: 10.1093/emboj/cdg547 Antagonistic control of disease resistance protein stability in the plant immune system.2005 · DOI: 10.1126/science.1109977 Enhanced defense responses in Arabidopsis induced by the cell wall protein fractions from Pythium oligandrum require SGT1, RAR1, NPR1 and JAR1.2009 · DOI: 10.1093/pcp/pcp044 Specific Arabidopsis HSP90.2 alleles recapitulate RAR1 cochaperone function in plant NB-LRR disease resistance protein regulation.2009 · DOI: 10.1073/pnas.0904877106

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0535400`	Involved in basal disease resistance to virulent strain of bacterial blight (X.oryzae) and compatible race of rice blast fungus (M.grisea).	RAR1 and HSP90 form a complex with Rac/Rop GTPase and function in innate-immune responses in rice.2007 · DOI: 10.1105/tpc.107.055517 OsRAR1 and OsSGT1 physically interact and function in rice basal disease resistance.2008 · DOI: 10.1094/mpmi-21-3-0294

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012001 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002679 respiratory burst involved in defense response Biological Process

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010824 regulation of centrosome duplication Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050821 protein stabilization Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0031267 small GTPase binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G51700

xla:414542

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.549

Rank 1 · TkA02G593980 · TK1151

Nucleus0.433

Rank 2 · TkA02G593980 · TK1151

Mitochondrion0.088

Rank 3 · TkA02G593980 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA02G593980 · TK1151

Cell membrane0.070

Rank 5 · TkA02G593980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04968CHORD38-72 aa

PF26782DUF825448-80 aa

PF04968CHORD161-221 aa

PF26782DUF8254166-186 aa

PF26782DUF8254197-222 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G593980	`PF04968`	CHORD	38	72	8e-39	132.8
TkA02G593980	`PF26782`	DUF8254	48	80	4.3	8.5
TkA02G593980	`PF04968`	CHORD	161	221	8e-39	132.8
TkA02G593980	`PF26782`	DUF8254	166	186	4.3	8.5
TkA02G593980	`PF26782`	DUF8254	197	222	4.3	8.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SE33`	Arabidopsis thaliana	sp\|Q9SE33\|RAR1_ARATH Cysteine and histidine-rich domain-containing protein RAR1	70.000%	Swiss-Prot	High
`Q6EPW7`	Oryza sativa subsp. japonica	sp\|Q6EPW7\|RAR1_ORYSJ Cysteine and histidine-rich domain-containing protein RAR1	64.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card