TkA02G593320 | RubberDandelionOmics

Gene overview

TkA02G593320

Reference: TK1151 Chr: Chr02 Coordinates: 153054892-153059411 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1742 bp · TkA02G593320|TK1151|cDNA

GAAAGCATGGCTCTATCAAAAATTCAAAATCAAATTCAAACGTTTTGCCCAAGAAACAAGATCCTGTCCGCCGATTCTACCAACGGTTCAGATTAACTCATCCAGTCCTTTAATACACTCGACTTCGAAGACATCGTTACGTTCAAAAAGTCTGTCTGATTTCTCATTTTTGTCAAACAGAACAAAATGGCAACTATCAAGGCCGTGAAAGCTCGTCAGATATTCGACAGCCGCGGTAATCCTACAGTCGAAGTCGATGT...

CDS

Download CDS FASTA

1338 bp · TkA02G593320|TK1151|CDS

ATGGCAACTATCAAGGCCGTGAAAGCTCGTCAGATATTCGACAGCCGCGGTAATCCTACAGTCGAAGTCGATGTTACACTTTCTGATGGAACATTGGCAAGAGCTGCAGTACCTAGCGGTGCTTCAACCGGTGTATACGAAGCCCTAGAATTAAGAGATGGAGGTTCTGACTACCTCGGAAAAGGTGTCCTGAAGGCTGTGGATAATGTCAACTCAATAATCGGACCTGCCTTGATTGGCAAGGATCCTTCAGAACAGAC...

Protein

Download Protein FASTA

445 aa · TkA02G593320|TK1151|PROTEIN

MATIKAVKARQIFDSRGNPTVEVDVTLSDGTLARAAVPSGASTGVYEALELRDGGSDYLGKGVLKAVDNVNSIIGPALIGKDPSEQTKIDNFMVQELDGTVNEWGWCKQKLGANAILAVSLAVCKAGASVKKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTGKVVIGMDVAASEFYENK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G593320`
TK1151 ID	TkA02G593320
OH-1004 ID	LXL04_012006
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G593320

Location Chr02:153054892-153059411 (-)

Description Similar to ENO1: Enolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0167300`	Enolase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012006 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004634 phosphopyruvate hydratase activity Molecular Function

KEGG gene cross-reference

dosa:Os10g0167300

rcu:8288376

zma:542316

zma:732811

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.713

Rank 1 · TkA02G593320 · TK1151

Nucleus0.247

Rank 2 · TkA02G593320 · TK1151

Mitochondrion0.134

Rank 3 · TkA02G593320 · TK1151

Cell membrane0.109

Rank 4 · TkA02G593320 · TK1151

Endoplasmic reticulum0.080

Rank 5 · TkA02G593320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03952Enolase_N4-139 aa

PF00113Enolase_C148-440 aa

PF13378MR_MLE_C289-402 aa

PF07476MAAL_C300-401 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G593320	`PF03952`	Enolase_N	4	139	5.3e-54	182.6
TkA02G593320	`PF00113`	Enolase_C	148	440	1.7e-158	527.3
TkA02G593320	`PF13378`	MR_MLE_C	289	402	7.3e-07	29.8
TkA02G593320	`PF07476`	MAAL_C	300	401	0.00012	22.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42971`	Oryza sativa subsp. japonica	sp\|Q42971\|ENO_ORYSJ Enolase	91.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card