TkA02G590160 | RubberDandelionOmics

Gene overview

TkA02G590160

Reference: TK1151 Chr: Chr02 Coordinates: 152294437-152295558 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

949 bp · TkA02G590160|TK1151|cDNA

TACGACTCCCATTTGAAACTGTCTGTTCCCTCTTCATCATCAATGGCATCTCTGAAAACAAGATTGGAGCACTCCGTCACTCCCACAGCACTCAGATCTTATCTCGCAGAGTTCCTGTCCACCTTTTTCTTCGTCTTCGCCGCTGTCGGATCCGCTATGGCCTCAAGAAAGATGTCGCCGGAAGCAGCACTGATTTGTCCTTCTAGTCTGGTAGCGTCAGCGATCGCAACTGCCTTTTCATTGTCAGTCGCGGTTTATGT...

CDS

Download CDS FASTA

765 bp · TkA02G590160|TK1151|CDS

ATGGCATCTCTGAAAACAAGATTGGAGCACTCCGTCACTCCCACAGCACTCAGATCTTATCTCGCAGAGTTCCTGTCCACCTTTTTCTTCGTCTTCGCCGCTGTCGGATCCGCTATGGCCTCAAGAAAGATGTCGCCGGAAGCAGCACTGATTTGTCCTTCTAGTCTGGTAGCGTCAGCGATCGCAACTGCCTTTTCATTGTCAGTCGCGGTTTATGTTGCCGTTAATATTTCCGGTGGCCATGTGAATCCGGCAGTGAC...

Protein

Download Protein FASTA

254 aa · TkA02G590160|TK1151|PROTEIN

MASLKTRLEHSVTPTALRSYLAEFLSTFFFVFAAVGSAMASRKMSPEAALICPSSLVASAIATAFSLSVAVYVAVNISGGHVNPAVTFGMAIGGHITIPMTIFYWISQMLGSVIACGLLKVFTVTQNVPVHGIPSEMTGFGASVLEGVMTFALVYTVYAAGDPRRGAFGTIGPLVIGLIAGANVLASGPFTGGSMNPAHSFGAAFVGGTFKNQAAYWIGPLIGAAMASVIYDNVVFPSQSPEDSVRGVTDAIVV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G590160`
TK1151 ID	TkA02G590160
OH-1004 ID	LXL04_029767
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.100
Protein coverage (%)	TK1151 88.189 / OH-1004 89.600 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G590160

Location Chr02:152294437-152295558 (-)

Description Similar to TIP2-3: Aquaporin TIP2-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47440`	Potential aquaporin, which may facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At3g16240`	Aquaporin required to facilitate the transport of water from the vacuolar compartment to the cytoplasm.	No verified direct reference in this release
`At4g17340`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0550800`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029767 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0032586 protein storage vacuole membrane Cellular Component

GO:0042807 central vacuole Cellular Component

GO:0015200 methylammonium transmembrane transporter activity Molecular Function

GO:0015250 water channel activity Molecular Function

KEGG gene cross-reference

ath:AT5G47450

nta:107817944

zma:541895

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.528

Rank 1 · TkA02G590160 · TK1151

Lysosome / Vacuole0.236

Rank 2 · TkA02G590160 · TK1151

Endoplasmic reticulum0.130

Rank 3 · TkA02G590160 · TK1151

Cytoplasm0.098

Rank 4 · TkA02G590160 · TK1151

Golgi apparatus0.048

Rank 5 · TkA02G590160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230MIP13-231 aa

PF11085YqhR27-39 aa

PF11085YqhR96-158 aa

PF11085YqhR208-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G590160	`PF00230`	MIP	13	231	9e-62	209.5
TkA02G590160	`PF11085`	YqhR	27	39	2.2	8.9
TkA02G590160	`PF11085`	YqhR	96	158	2.2	8.9
TkA02G590160	`PF11085`	YqhR	208	231	2.2	8.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STX9`	Arabidopsis thaliana	sp\|Q9STX9\|TIP51_ARATH Probable aquaporin TIP5-1	50.000%	Swiss-Prot	High
`Q41951`	Arabidopsis thaliana	sp\|Q41951\|TIP21_ARATH Aquaporin TIP2-1	50.700%	Swiss-Prot	High
`Q41975`	Arabidopsis thaliana	sp\|Q41975\|TIP22_ARATH Probable aquaporin TIP2-2	48.300%	Swiss-Prot	Medium
`Q7XU31`	Oryza sativa subsp. japonica	sp\|Q7XU31\|TIP51_ORYSJ Probable aquaporin TIP5-1	48.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card