RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G589340
Reference: TK1151 Chr: Chr02 Coordinates: 152092432-152094031 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

988 bp · TkA02G589340|TK1151|cDNA

CCCCTCTTCATAAACCAGTTAAAACTCTATGGCTGTTAGCAGTGGTGTCGGGAAGTACAATGGTCGGATAACACCGTTTGTGGTGTTGTCATGTATGGTTGCTGCAACCGGAGGAATCATTTTCGGATATGATATCGGAATTTCAGGTGGAGTGACCTCCATGGAGGCATTTTTAAGGAAATTCTTCCCGGATGTATTTGCCAAGATGATACACGACACCAAGATAAGCAACTACTGCAAATTCGATAGCCAACTACTGA...

CDS

Download CDS FASTA

960 bp · TkA02G589340|TK1151|CDS

ATGGCTGTTAGCAGTGGTGTCGGGAAGTACAATGGTCGGATAACACCGTTTGTGGTGTTGTCATGTATGGTTGCTGCAACCGGAGGAATCATTTTCGGATATGATATCGGAATTTCAGGTGGAGTGACCTCCATGGAGGCATTTTTAAGGAAATTCTTCCCGGATGTATTTGCCAAGATGATACACGACACCAAGATAAGCAACTACTGCAAATTCGATAGCCAACTACTGACTTCCTTCACATCTTCACTATACATAGC...

Protein

Download Protein FASTA

320 aa · TkA02G589340|TK1151|PROTEIN

MAVSSGVGKYNGRITPFVVLSCMVAATGGIIFGYDIGISGGVTSMEAFLRKFFPDVFAKMIHDTKISNYCKFDSQLLTSFTSSLYIAGLIATFFASPVTKAYGRKPSILIGGVAFLAGAAFGGAAYNIYMLIIGRVLLGVGVGFANQSVPLYLSEMAPSQYRGAFNMGFQFCVGIGVLTANLLNYGTQKIQGGWGWRISLAMAALPASVLTFGSFFLPETPNSLIQHNKDPDKANQMLQKIRGTENVQAEFNDLVTANEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G589340
TK1151 IDTkA02G589340
OH-1004 IDLXL04_027185
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)60.100
Protein coverage (%)TK1151 97.188 / OH-1004 59.501
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G589340
LocationChr02:152092432-152094031 (+)
DescriptionSimilar to STC: Sugar carrier protein C
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g61520 Mediates an active uptake of hexoses, probably by sugar/hydrogen symport. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0559700 Mediates active uptake of hexoses by sugar:proton symport (Probable).
Molecular cloning, functional characterization and expression analysis of a novel monosaccharide transporter gene OsMST6 from rice (Oryza sativa L.).2008 · DOI: 10.1007/s00425-008-0755-8
Os07g0106200 Mediates active uptake of hexoses by sugar:proton symport.
Characterization and expression of monosaccharide transporters (osMSTs) in rice.2000 · DOI: 10.1093/pcp/pcd016
Os01g0567500 Mediates active uptake of hexoses by sugar:proton symport (By similarity).
Effects of chilling on male gametophyte development in rice.2006 · DOI: 10.1016/j.cellbi.2006.03.004
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027185 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009624 response to nematode Biological Process
GO:0015749 monosaccharide transmembrane transport Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0016020 membrane Cellular Component
GO:0015145 monosaccharide transmembrane transporter activity Molecular Function
GO:0015293 symporter activity Molecular Function
KEGG gene cross-reference
ath:AT1G11260
ath:AT4G21480
dosa:Os07g0106200
dosa:Os07g0559700
osa:4343590
rcu:8275367
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.866
Rank 1 · TkA02G589340 · TK1151
Cytoplasm0.111
Rank 2 · TkA02G589340 · TK1151
Endoplasmic reticulum0.039
Rank 3 · TkA02G589340 · TK1151
Mitochondrion0.036
Rank 4 · TkA02G589340 · TK1151
Lysosome / Vacuole0.024
Rank 5 · TkA02G589340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_19-33 aa
PF13347MFS_212-32 aa
PF00083Sugar_tr22-316 aa
PF12051DUF353372-135 aa
PF13347MFS_273-146 aa
PF07690MFS_174-315 aa
PF06609TRI1281-209 aa
PF13347MFS_2169-217 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G589340PF07690MFS_19339e-2071.6
TkA02G589340PF13347MFS_212320.008315.4
TkA02G589340PF00083Sugar_tr223161.4e-72245.8
TkA02G589340PF12051DUF3533721350.739.4
TkA02G589340PF13347MFS_2731460.008315.4
TkA02G589340PF07690MFS_1743159e-2071.6
TkA02G589340PF06609TRI12812095e-0522.7
TkA02G589340PF13347MFS_21692170.008315.4
TkA02G589340PF11992TgpA_N1732341.78.3
TkA02G589340PF06609TRI122002595e-0522.7
TkA02G589340PF12051DUF35332372910.739.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8L7R8Arabidopsis thalianasp|Q8L7R8|STP3_ARATH Sugar transport protein 364.000%Swiss-ProtHigh
Q6Z401Oryza sativa subsp. japonicasp|Q6Z401|MST6_ORYSJ Sugar transport protein MST663.200%Swiss-ProtHigh
Q7EZD7Oryza sativa subsp. japonicasp|Q7EZD7|MST3_ORYSJ Sugar transport protein MST363.100%Swiss-ProtHigh
Q94EC4Oryza sativa subsp. japonicasp|Q94EC4|MST8_ORYSJ Sugar transport protein MST859.900%Swiss-ProtHigh

JBrowse

View in Genome Browser