Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1956 bp · TkA02G588170|TK1151|cDNA
CTGAAAGTCTTCAAAACAGAAGTTGATGCATACAGTGAAACAAGTGGTTCTCTGATCAGTTTACTAGCACCACATATCAAACCTTCGTCTCCATCTCTCTCCTCGATCTCTTTCAAATTACAGCAGTCATCATCTACGCCGATTAAGGCAGAAATTTCAAGCGATCTCCAACAAACCTGAAGACCTGTTCAGCAATGCTGTTTATCGTTGCTGTAAAAAAACTTTCGCAAAGCATGTGACACTAATTCCAGTAAACCTAA...
1488 bp · TkA02G588170|TK1151|CDS
ATGGCTACAACTACAGTTATCGGATTAAAAGCAGGAAAACGAATCTTTCGTTCATCATCTTATTACTCCGACGTCAATGAAAAGCTATCCTGCAGTAGCAATCTGTGGTTCATATACGTCCCCACCACAAATTCAATCACTTCAAAGAAGTCACACAGTTTCATATACAGTCGAGATAATCCTCATCCTGTCAGAGCTCTAAAGGAACATGTAGATACTACTATTAATCCTCCAATTACAGACAAATGGGTTCAGGGATT...
Protein
Download Protein FASTA495 aa · TkA02G588170|TK1151|PROTEIN
MATTTVIGLKAGKRIFRSSSYYSDVNEKLSCSSNLWFIYVPTTNSITSKKSHSFIYSRDNPHPVRALKEHVDTTINPPITDKWVQGFDHLDEEVFDDELPVEALLLLHKSLLEKQWTLSTDTQTEKKTRKVRVTGSGVSARRRRIDAQNKTLTGTCSVNQVGGNKQLRSIISPELLQICQKGYLKGGKNEPLLTHSEVVALSEKIKIGLHLEEEKSRLKERLGSEPSEKQLADSLKISRVELQAKQIECSLAREKLALSN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G588170 |
|---|---|
| TK1151 ID | TkA02G588170 |
| OH-1004 ID | LXL04_012087 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.400 |
| Protein coverage (%) | TK1151 98.990 / OH-1004 87.657Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G588170 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:151787263-151790624 (+) | ||||||||||||
| Description | Similar to SIGA: RNA polymerase sigma factor sigA | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006352 DNA-templated transcription initiation Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0071461 cellular response to redox state Biological Process GO:0071482 cellular response to light stimulus Biological Process GO:0080005 photosystem stoichiometry adjustment Biological Process GO:2001141 regulation of RNA biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:1903865 sigma factor antagonist complex Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function GO:0003677 DNA binding Molecular Function GO:0003899 DNA-directed RNA polymerase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ana:all7615 ath:AT1G64860 dosa:Os08g0163400 osa:4344738 syf:Synpcc7942_0672 syf:Synpcc7942_1746 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16994Glyco_trans_4_5105-138 aaPF04539Sigma70_r3212-238 aaPF04545Sigma70_r4219-239 aaPF04542Sigma70_r2259-320 aaPF16994Glyco_trans_4_5280-335 aaPF04539Sigma70_r3335-406 aaPF13730HTH_36338-352 aaPF13730HTH_36353-373 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G588170 | PF16994 | Glyco_trans_4_5 | 105 | 138 | 0.091 | 13.1 |
| TkA02G588170 | PF04539 | Sigma70_r3 | 212 | 238 | 1.9e-14 | 54.2 |
| TkA02G588170 | PF04545 | Sigma70_r4 | 219 | 239 | 9.2e-11 | 41.8 |
| TkA02G588170 | PF04542 | Sigma70_r2 | 259 | 320 | 2.1e-15 | 56.9 |
| TkA02G588170 | PF16994 | Glyco_trans_4_5 | 280 | 335 | 0.091 | 13.1 |
| TkA02G588170 | PF04539 | Sigma70_r3 | 335 | 406 | 1.9e-14 | 54.2 |
| TkA02G588170 | PF13730 | HTH_36 | 338 | 352 | 0.064 | 13.8 |
| TkA02G588170 | PF13730 | HTH_36 | 353 | 373 | 0.064 | 13.8 |
| TkA02G588170 | PF04545 | Sigma70_r4 | 356 | 370 | 9.2e-11 | 41.8 |
| TkA02G588170 | PF04545 | Sigma70_r4 | 432 | 480 | 9.2e-11 | 41.8 |
| TkA02G588170 | PF13730 | HTH_36 | 451 | 469 | 0.064 | 13.8 |
| TkA02G588170 | PF04539 | Sigma70_r3 | 455 | 471 | 1.9e-14 | 54.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.